(data stored in ACNUC7421 zone)

EMBL: CP001349.PE544

CP001349.PE544       Location/Qualifiers
FT   CDS_pept        complement(622354..622869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0559"
FT                   /product="peptidase S24 and S26 domain protein"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   mpo:Mpop_0340 peptidase S24 and S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55596"
FT                   /db_xref="GOA:B8IDM4"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM4"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACL55596.1"
FT                   /translation="MSLYRVGEQAADWSGLVRIPFMRTTLCAGFPSSAEDFTEGALELP
FT                   RWLAPNPAATFIWRVRGWCMKGAGIHDQDLAVVDRSLHPSPGAVVVAIVNGEMSLKRLV
FT                   LDGNRLALTFDNPEMPAFGLEDLEECQIWGVLLFSVRWHHVRPSPLRWPRHRAGRRQQL
FT                   LLLLREGV"
     gtgagtctct accgggtcgg cgagcaggca gcagactgga gtgggctggt gcgcatcccg        60
     ttcatgcgca ccaccctctg cgccggcttc ccgtcctcgg ccgaggactt caccgagggc       120
     gccctcgagc tcccgcgctg gctcgccccc aaccccgccg cgaccttcat ctggcgcgtc       180
     cgcggctggt gcatgaaggg cgccggcatc catgaccagg acctcgccgt cgtcgaccgc       240
     tccctccacc ccagccccgg cgctgtcgtc gttgcgattg tgaacggcga gatgagcctc       300
     aagcgcctcg tgctcgacgg caaccgcctc gcgctcacct tcgacaaccc ggagatgccc       360
     gccttcggcc tggaggatct ggaggagtgc cagatctggg gcgtgctgct gttctcggtg       420
     cgctggcacc acgtccggcc gagccccctg cgatggccgc gccatcgcgc tggtcgacgg       480
     caacagcttc tactgctcct gcgcgagggt gtttga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page