(data stored in ACNUC7421 zone)

EMBL: CP001349.PE545

CP001349.PE545       Location/Qualifiers
FT   CDS_pept        complement(624239..626215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3393 putative ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55597"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55597.1"
FT                   /translation="MLTKQDKQQKITYCTNMNEVFEAKLGSADLLLNWDHLRGRIRDRV
FT                   DAGDIGSAFLKLALDVAHVLPDGVDDQLARAAFHFQSAKGAKSKHADSVQAGLRVLSID
FT                   LGVRSFATCSVFELKDTAPTTGVAFPLAEFRLWAVHERSFTLELPGENVGAAGQQWRAQ
FT                   ADAELRQLRGGLNRHRQLLRAATVQKGERDAYLTDLREAWSAKELWPFEASLLSELERC
FT                   STVADPLWQDTCKRAARLYRTEFGAVVSEWRSRTRSREDRKYAGKSMWSVQHLTDVRRF
FT                   LQSWSLAGRASGDIRRLDRERGGVFAKDLLDHIDALKDDRLKTGADLIVQAARGFQRNE
FT                   FGYWVQKHAPCHVILFEDLSRYRMRTDRPRRENSQLMQWAHRGVPDMVGMQGEIYGIQD
FT                   RRDPDSARKHARQPLAAFCLDTPAAFSSRYHASTMTPGIRCHPLRKREFEDQGFLELLK
FT                   RENEGLDLNGYKPGDLVPLPGGEVFVCLNANGLSRIHADINAAQNLQRRFWTQHGDAFR
FT                   LPCGKSAVQGQIRWAPLSMGKRQAGALGGFGYLEPTGHDSGSCQWRKTTEAEWRRLSGA
FT                   QKDRDEAAAAEDEELQGLEEELLERSGERVVFFRDPSGVVLPTDLWFPSAAFWSIVRAK
FT                   TVGRLRSHLDAQAEASYAVAAGL"
     gtgctcacga agcaggacaa gcagcagaag atcacctact gcaccaacat gaatgaggtg        60
     ttcgaagcca agcttgggag cgctgacctt ctattgaact gggaccatct gcgtggtcgc       120
     attcgtgatc gcgtcgatgc tggcgatatc ggttcagcgt tcctcaagct ggcgctcgac       180
     gtcgctcacg tcttaccgga cggcgttgac gatcagcttg caagggctgc cttccacttc       240
     cagtcggcga agggagccaa gagcaagcac gctgacagtg tccaagccgg ccttcgagtc       300
     ctttccatcg acctcggagt tcgctcgttc gcgacgtgct cagtgttcga gttgaaggat       360
     acggccccaa ccaccggcgt cgcgtttcca ctcgccgagt tccggctgtg ggcggtacac       420
     gagaggtcct tcacgctcga gctgccgggt gagaacgtcg gggctgctgg ccaacagtgg       480
     cgggctcagg ctgacgccga actccgtcag ctccgtggtg ggctgaaccg gcaccgccaa       540
     cttctacgag cagcgaccgt ccagaagggg gagcgagacg cttatctcac cgacctccgc       600
     gaggcctggt cggcgaagga gctatggccg ttcgaggcca gcctgctctc tgagttggag       660
     cggtgctcga ccgtcgctga tccgctctgg caggacacct gtaaacgggc tgctcgcctg       720
     tatcgcaccg agttcggcgc cgtcgtctcc gagtggcgca gccggacgcg atcccgcgaa       780
     gaccgcaagt acgccggcaa gtcgatgtgg tcggtccagc acctgaccga cgtccgccgt       840
     ttccttcaga gctggtccct ggcgggtcgg gcctcgggtg acatccgccg gctcgatcgc       900
     gaacgagggg gtgtcttcgc caaggacctc ctggatcaca tcgacgccct gaaggacgac       960
     aggctcaaga cgggtgctga cctgatcgtc caggcggctc gaggcttcca gcgcaacgag      1020
     ttcgggtact gggtgcagaa gcacgcccct tgtcacgtca tcctgttcga ggatctgagc      1080
     cggtaccgca tgcggaccga ccgccctcgt cgagagaact cccagctcat gcagtgggcc      1140
     catcgtggcg tgcccgacat ggtcggcatg cagggcgaga tctacgggat ccaagatcga      1200
     cgggatccgg acagcgctcg caagcatgcg cgtcagcctc ttgccgcatt ctgcctcgat      1260
     accccggctg cattctcgag ccgctatcac gcttccacga tgacgccagg gattcggtgt      1320
     catcccctgc gcaagaggga attcgaggat caaggcttcc ttgagctgct caagcgagag      1380
     aacgagggcc tcgatctcaa cggctacaag ccgggcgatc tcgttcctct ccccggggga      1440
     gaggtgttcg tctgcctgaa cgccaatggc ttgtcccgca tccacgccga catcaacgcc      1500
     gcccagaacc tgcagaggcg tttctggacg cagcacggcg acgcgttccg cctcccatgc      1560
     gggaagtcgg cggtccaagg tcagatccgg tgggctcccc tgagcatggg caagcgccaa      1620
     gcgggcgctc tcggcgggtt tgggtatctc gagccaacgg gacatgacag cggttcatgt      1680
     cagtggcgca aaacgactga ggcagagtgg cgccgcctct ctggcgcaca gaaggatcgt      1740
     gatgaggcgg ctgcagcgga ggatgaagag ctgcagggcc ttgaggagga actgctcgag      1800
     cggagtggcg agcgcgtcgt cttcttccgc gatccgtccg gtgtcgtgct gccgaccgat      1860
     ctctggttcc cgtcagcggc cttctggtcg atcgtccgcg caaaaacggt ggggcgcttg      1920
     agatcgcact tggacgctca ggccgaagca agctatgctg ttgctgctgg cctatag         1977
//

If you have problems or comments...

PBIL Back to PBIL home page