(data stored in ACNUC7421 zone)

EMBL: CP001349.PE546

CP001349.PE546       Location/Qualifiers
FT   CDS_pept        complement(626253..627647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55598"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55598.1"
FT                   /translation="MPVRSLKLKIVVPRHPSELEKAQALWSTHRLVNEAVSFYEQKLLL
FT                   LRGETYSTSDGSVPQDEVRRQLLEQAREAQARNGGSGGSDDEIVRLCRSLYEAIVLADD
FT                   ANAQLANAFLGPLTDPNSAGFLEAFNKVDRPAPSWLDQVPASDPIDPAVLAEANAWLDT
FT                   DAGRAWLVDTGAPPRWRSLAAKQDPIWPREFARKLGELRKEAASGTSAIIKALKRDFGV
FT                   LPLFQPSLAPRILGSRSSLTPWDRLAFRLAVGHLLSWESWCTRARDEHTARVQRLEQFS
FT                   SAHLKGDLATKVSTLREYERARKEQIAQLGLPMGERDFLITVRMTRGWDDLREKWRRSG
FT                   DKGQEALHAIIATEQTRKRGRFGDPDLFRWLARPENHHVWADGHADAVGVLARVNAMER
FT                   LVERSRDTALMTLPDPVAHPRSAQWEAEGGSNLRNYQLEAVGGELQITLPLLKAADDGR
FT                   CIDTPL"
     atgcctgttc gctcgcttaa actgaagatc gtcgttcctc ggcacccgtc cgagctggag        60
     aaggcccaag cgctctggag cacgcatcgt ctcgtcaatg aggcggtcag tttctacgag       120
     cagaagctgc tgcttcttcg gggcgagacc tacagcacga gtgacggctc tgtgcctcaa       180
     gacgaggtcc gacgccagct gctcgaacaa gcccgtgagg cgcaggcccg gaacggtggg       240
     tcaggcggat ctgacgacga gattgtacga ttgtgccggt ccttgtatga ggcgatcgtt       300
     ctcgccgacg acgcgaatgc ccaactcgcg aacgcttttc tcggcccgct gacggatccg       360
     aacagcgccg gctttctgga agctttcaac aaggtcgaca ggcctgctcc gagctggctc       420
     gatcaggtgc cggcatcgga tccgatcgat cctgccgttc tcgcggaagc gaatgcatgg       480
     ctcgacaccg atgctggtcg agcgtggctc gtcgacacgg gagcgcctcc gcggtggcgc       540
     agtctcgccg ccaaacagga tccgatctgg ccgcgtgagt tcgctcgcaa gttgggcgaa       600
     ctgaggaagg aggccgccag cggcacctcg gcgatcatca aggccctgaa gagggacttc       660
     ggtgttctcc cgctctttca gccgtcgctc gcaccgcgca tcctcgggtc gaggagcagc       720
     ctcacaccct gggatcgtct cgccttccgc cttgccgtcg gccatctcct gtcctgggag       780
     agttggtgca cgcgagcccg ggacgagcac accgctcgag tccagcggct tgagcagttc       840
     agctccgcgc acctgaaggg tgatctcgcg accaaggtca gcacgctgcg cgagtatgag       900
     cgcgcccgca aagagcagat cgcgcagctc ggtctaccga tgggcgagcg cgacttcctc       960
     atcaccgtcc gcatgacgcg gggctgggac gacctgcgcg agaagtggcg ccgcagcgga      1020
     gacaagggac aagaggcact tcatgccatc atcgccacgg aacagacgcg caagcgcggg      1080
     cgcttcggcg atccggatct cttccgctgg cttgctcgcc ctgagaacca tcacgtctgg      1140
     gcggacggcc atgctgatgc ggtcggggtt cttgcgcgcg tcaatgccat ggagcggctg      1200
     gtcgagagat cccgcgacac ggcgctgatg acgctgcccg atccggttgc tcacccccgt      1260
     tcagcgcagt gggaagccga aggtgggagc aacctccgca actaccaact cgaggccgtt      1320
     gggggtgagc tgcagatcac tcttccgctc ctgaaggctg ccgacgacgg ccgttgcatc      1380
     gacacccccc tataa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page