(data stored in ACNUC7421 zone)

EMBL: CP001349.PE547

CP001349.PE547       Location/Qualifiers
FT   CDS_pept        complement(627980..628339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_1869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55599"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55599.1"
FT                   /translation="MSIDRRLLARARAPLSVQYRYCCRRLIEDAIEALITCLDEADGDP
FT                   DLEDEGDDEPSLGSPERTAEFGVTVIDGDRYHILSTSQIRWGDGGTMDCEVEDEHDEDG
FT                   GDAEPDGDEHDDGSS"
     atgtcgatcg atcgccgtct cttggcgcgc gctcgtgcgc cgttgtccgt gcaataccgc        60
     tactgctgcc gccgcctaat tgaagatgcc atcgaggcct tgatcacctg cctcgacgag       120
     gccgacggcg accccgacct ggaggacgag ggcgacgacg agccctccct gggctccccg       180
     gagcgcacgg cggagttcgg ggtgaccgtc atcgacggcg accgctacca catcctcagc       240
     acgtcgcaga tccgctgggg ggatggcggc acgatggatt gcgaggtgga ggacgagcac       300
     gacgaggacg gtggggatgc cgagccggat ggtgatgagc acgacgacgg ctcgtcctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page