(data stored in ACNUC7421 zone)

EMBL: CP001349.PE548

CP001349.PE548       Location/Qualifiers
FT   CDS_pept        complement(628949..629218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55600"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55600.1"
FT                   /translation="MNPFRWFWPQRCDDPLIEPSQGARLRLALAEQRHRRLACDLIRVA
FT                   LDEVDRTAAELGTPVALNPAWLQQAVAELRRRYQGAHGRQSGGA"
     gtgaacccgt tccgctggtt ctggccacag cgctgtgacg accccctgat cgagccgtcc        60
     cagggtgccc gcctgcggct ggctctggcc gagcagcggc atcggcgctt ggcgtgcgat       120
     ctcatccggg tcgctctgga cgaggtcgat cgcacggcag ccgagctggg cactccggtt       180
     gcgttgaatc cagcatggct gcagcaggcg gtcgccgagc tgaggcgtcg ctaccaggga       240
     gcgcacggca ggcagtccgg gggtgcctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page