(data stored in ACNUC7421 zone)

EMBL: CP001349.PE549

CP001349.PE549       Location/Qualifiers
FT   CDS_pept        complement(629215..629622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55601"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55601.1"
FT                   /translation="MTPLELAGLLKDYGPWSLLALTLLAMSYLQRRYDAVTEKYQSNLE
FT                   ALIGKLAVTVERNNGTNAAVTAALESRTGIFERLHEAVEQAKAETRTLITDLKNHGVIN
FT                   DQWTREKLDMTVGRIETILEHIDELRRGMGR"
     gtgacacccc tcgaactggc cggtctcctc aaggactatg gtccctggag ccttcttgcg        60
     ctcacgctcc tggccatgtc gtacctgcag cgacgctacg atgccgtgac cgagaagtac       120
     cagagcaacc tggaggccct gatcgggaaa ctcgccgtca cggtcgagcg gaacaacggc       180
     acgaatgccg ccgttacggc agccttggag agccggaccg gcatcttcga gcgcctgcat       240
     gaggcggtgg agcaggccaa agccgaaacg cgcaccctga tcaccgacct gaagaatcac       300
     ggggtcatca acgaccagtg gaccagggag aagctcgaca tgacggtagg acgcatcgag       360
     acgatcctgg agcacattga cgaactccgg cgggggatgg gccggtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page