(data stored in ACNUC7421 zone)

EMBL: CP001349.PE55

CP001349.PE55        Location/Qualifiers
FT   CDS_pept        complement(62722..63492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0056"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_0056 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55107"
FT                   /db_xref="GOA:B8IU62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU62"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55107.1"
FT                   /translation="MNARPSLVPEPLLSVQGVTLQYKTSDHLVTATYRVDFEVLPGDRY
FT                   ILLGPSGCGKSTLLKAIGGYLTPVEGEIRLKGRKVSEPGPDRMMVFQEFDQLLPWKTVK
FT                   QNVAFALTASGRASGPEAMDRAMAYIEKVGLAKFADSYPHMLSGGMKQRVAIARGMAME
FT                   PDILLMDEPFAALDALTRRKMQDELLRLWEDTRFTVLFVTHSIEEAIKVGTRILLLSPH
FT                   PGQVRAELNSLAPSELGTAAQGALEARINDMLFA"
     atgaacgcac gcccgagcct cgtcccggag ccgctgctct cggtccaggg cgtcacgctc        60
     cagtacaaga ccagcgatca cctcgtcacc gcgacctacc gggtggattt cgaggtgctg       120
     cccggcgacc gctacatcct gctcgggcct tcgggctgcg ggaaatcgac cctgctcaag       180
     gcgatcggcg gctatctgac ccccgtcgag ggtgagatcc ggctgaaggg ccgcaaggtc       240
     agcgagcccg gccccgaccg catgatggtt tttcaggaat tcgaccagct cctgccctgg       300
     aagaccgtca agcagaacgt cgccttcgcg ctgaccgcga gcggccgggc ctccgggcct       360
     gaggccatgg accgggcgat ggcctatatc gagaaggtcg gcctcgcgaa attcgccgat       420
     tcctacccgc acatgctgtc gggcggcatg aagcagcgcg tcgcgatcgc ccgcggcatg       480
     gcgatggagc ccgacatcct gctcatggac gagcccttcg cggcgctcga cgcgctcacc       540
     cgccgcaaga tgcaggacga gctgctccgg ctgtgggagg acacccgctt cacggtcctg       600
     ttcgtcaccc attccatcga ggaggcgatc aaggtcggga cgcgcatcct gctgctctcg       660
     ccccatccgg gccaggtcag ggcggagctg aacagcctcg cgccgtccga gctcggcacc       720
     gccgcccagg gcgccctcga agcccgcatc aacgacatgc tcttcgcttg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page