(data stored in ACNUC7421 zone)

EMBL: CP001349.PE551

CP001349.PE551       Location/Qualifiers
FT   CDS_pept        complement(630039..630797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4117 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55603"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55603.1"
FT                   /translation="MDRSISPGAAIVLDFIGQTEAPNGYGTIYANGQAKLGIDITTWTL
FT                   DQVEAEQPAWTRRFGSSACGRYQFMRDTLDKPGTIQDIEGEMGLTGRELFSPDLQDRMA
FT                   MHLLRRRGWDSFIAGRLTMAGFALSLAKEWASLPVLATTKGRKRTVMRGQSYYAGDGRN
FT                   RALVSADTVEAMLARALAAERSNPGQNSPGGKSLPDKAPPPLVADADVSPSKVAQPAPS
FT                   GGLSSGPTLSTAPAPTVAPWWRRALAWLSA"
     atggaccgct ccatctcccc gggcgccgcg atcgtgctcg acttcatcgg gcagaccgag        60
     gcgcccaacg gctacggcac gatctacgcc aacggccagg cgaagctcgg catcgacatc       120
     accacgtgga cgctcgatca ggtcgaggcc gagcagcctg cctggaccag gcgcttcgga       180
     tcgagcgcct gcggccgcta ccagttcatg cgcgacaccc tcgacaagcc cggcacgatc       240
     caggacatcg agggcgagat ggggttgacc ggccgcgaac tgttctcccc cgacctccag       300
     gaccggatgg cgatgcacct gctgcgtcgc cgcggctggg acagcttcat cgccggccgg       360
     ctgacaatgg ccggcttcgc gctcagcctc gccaaggaat gggcgagcct gccggtcctc       420
     gcgaccacca agggccggaa gcgcacggtc atgcgcggcc agagctacta tgcgggcgac       480
     gggcgcaaca gggcgctcgt ctcggccgac acggtcgagg cgatgctggc ccgagccctc       540
     gcggccgagc gatcaaatcc aggtcaaaac tcgcccggcg gtaagtcatt gccggataag       600
     gctccaccgc ctctggtggc cgacgccgac gtgtccccgt caaaagtcgc ccagcccgcc       660
     ccctccggcg ggctttcttc tggccccacg ctgtcgaccg ctcctgcgcc taccgtggcg       720
     ccctggtggc ggcgtgcgct cgcttggctc tcggcctga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page