(data stored in ACNUC7421 zone)

EMBL: CP001349.PE553

CP001349.PE553       Location/Qualifiers
FT   CDS_pept        complement(631281..633635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55605"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55605.1"
FT                   /translation="MRNLSRAVWLAAAVAVLAAPAVSLDLRRYINSGGEPPLTGAYALG
FT                   PGELVINSTDKKLFFRATDNTLGVATLLNASVAGKKAVEQGDAGDLVVTPSGSGSAQAV
FT                   KDLFSAVPVISGGAVSLLNGPTLGTWQAGKFTVTPDRLQASAATRASNPYAGPYPSWVQ
FT                   GIGLGNGPYSGFYDIKPLATATLYAPDGSVALTNRHTYGSLNTSGTLTVSANVDRPGCV
FT                   AGFTHPGQASAYDELGAYALCTQIDSVPLMAAVAGTFTATTFVPTTPITLSDTVYLGVG
FT                   MWIRTNDTPARYNGQIESWTTNGNGQVTSITVSQWTQRGGSAGTPAGTMAFINPQDKLW
FT                   NRLETTFLNAIKVTGTTVSDSKTVSVSSTDGLYPGGQLVAGPGIQPNTVITDVNYTGNT
FT                   ITLEKAATASGTVTLVISAGTEFGKGVGVEGDIFNAGPPFIPTEISGGTGNVTASSRTI
FT                   TGVTNISVWRSGIMVYGVGIPAGNLVTAVDTANSTLTLKYPATASGTGVALKAKHQLDE
FT                   GGTFADCVGVTNNINTCYLNRGSVSYGFVSMGAGEASFLVQPDLFAGIPKYGYQVNGTY
FT                   NGMPSIAAFAVTSDGTTLWKVDGAGNETVQSVTAQSVTAAGAVSGASLAATGAVSGASA
FT                   SIAGAVSAGSVSATGALSGASADVTGTYKVGGTTVLDNAAWTAYVPTVSCVTTGSLTVG
FT                   TVTARYKRIGKTVSVTVKAQLTANTCADGINVTVPVPVAADAPLYGRDIGTGVLLAGLA
FT                   AAGGGVAFVHRYDGGAPSAGGVLFSLTYETP"
     atgcgaaacc tctcccgtgc ggtctggctc gcggccgcgg tggccgtcct cgcggcgcct        60
     gctgtgtccc tcgacctgcg ccgctatatc aactctggag gcgagccacc gctaacgggc       120
     gcttacgcgc tcgggccagg cgagttggtg atcaactcga ccgacaagaa gctgttcttt       180
     cgcgcgaccg ataacacgct cggcgtcgcg accctgctca acgccagcgt ggccggtaag       240
     aaagctgtcg agcagggcga tgcaggcgac ctcgtcgtca cgccgagcgg cagcgggtcg       300
     gcgcaggctg tcaaggatct gttctcggcc gtgccggtca tcagcggggg cgccgtctcg       360
     ctgctcaacg gcccgacgct cgggacgtgg caggccggaa aattcactgt cacgccggac       420
     cgcctccagg ccagcgctgc gacccgcgcc tcgaaccctt acgccggccc ctatccgtcg       480
     tgggtgcagg ggatcgggct cggcaacggc ccttactccg gcttttatga catcaagccg       540
     ctggcaaccg cgacgctcta cgcgccggat ggatcggtgg cgttgaccaa tcggcacacc       600
     tatggctcgc tcaacacctc gggcacgctg accgtctcgg cgaatgtcga taggcccggc       660
     tgcgtcgcgg gcttcacgca ccccgggcag gcgagcgcat acgacgagct tggtgcctac       720
     gcgctctgta cgcagatcga cagcgtgccg ctgatggccg cggtcgccgg cacgttcacg       780
     gcgaccacct tcgttcccac gacgccgatc acgcttagcg ataccgttta tctcggcgtg       840
     ggaatgtgga tccgcacgaa tgacacgccg gcccgctaca acgggcagat cgaatcctgg       900
     acgacgaacg gaaatggaca ggtcacaagc atcacggtta gccaatggac gcagcgcggc       960
     ggctcggccg gaacgccggc cggaacgatg gcgttcatta acccgcagga taaactttgg      1020
     aatagattag agaccacctt cctcaacgca atcaaggtca ccggcacgac ggtctccgac      1080
     tcgaagacgg tctcggtcag cagcaccgac ggcctctatc cgggcggtca gcttgtggcc      1140
     gggcctggta tccagccgaa cactgtcatc accgacgtca actacaccgg caatacgatc      1200
     accctggaaa aggcggcgac cgcttcgggg accgtgaccc tggtcatctc ggctggcacc      1260
     gagttcggca agggcgtcgg cgtcgaaggt gatatcttca atgccggccc tccctttatt      1320
     cccaccgaga tctccggcgg cacgggcaat gtgaccgcga gcagccgcac catcacgggc      1380
     gtcacgaaca tctcggtatg gcgctcgggc atcatggtct atggggtggg cattccggcc      1440
     ggcaacctcg tgacggccgt cgatacggcc aactcgaccc tgacgctcaa gtatccggcg      1500
     acagcatcgg gaactggcgt cgcactcaaa gcgaagcatc agctcgacga gggcggcacc      1560
     tttgccgact gcgtcggggt cacgaacaac atcaatactt gctacctcaa tcgtggatcg      1620
     gtctcttacg gcttcgtgtc gatgggggcg ggcgaggcgt cgttcttggt gcagccggat      1680
     ctctttgccg ggatcccgaa gtacggctac caggtcaacg gcacgtacaa cggcatgcct      1740
     tcgattgccg cctttgccgt gaccagcgac ggcacgaccc tttggaaggt cgacggcgcc      1800
     ggtaatgaga ccgttcagag cgtgaccgcg cagagcgtga cggcggccgg ggcggtctcg      1860
     ggcgccagcc tcgcggcgac cggcgcggtg tcgggggcga gcgccagcat tgccggggcg      1920
     gtctcagccg ggagcgtcag tgctacgggc gcgctctccg gcgccagcgc cgacgtgacc      1980
     ggcacctaca aggtcggcgg cacgacggtc ctcgataatg cggcctggac ggcgtatgtg      2040
     cccaccgtgt cctgcgtaac gaccggctcc ctgaccgtgg gcacggtgac ggcccgctac      2100
     aagcgcatcg gcaagacggt gtccgtgacc gtcaaggcgc agttgaccgc caatacctgc      2160
     gcggacggca tcaacgtcac cgtgccggtc cccgtcgcgg ccgacgcgcc cttgtacggg      2220
     cgcgacatcg gcacgggcgt cctgctggcc ggactggctg cggccggcgg cggtgtggcg      2280
     ttcgtgcatc gctacgacgg cggcgcgcct tcggccggcg gcgtcttatt cagcctgact      2340
     tacgaaacgc cctga                                                       2355
//

If you have problems or comments...

PBIL Back to PBIL home page