(data stored in ACNUC7421 zone)

EMBL: CP001349.PE554

CP001349.PE554       Location/Qualifiers
FT   CDS_pept        complement(633645..634376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55606"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55606.1"
FT                   /translation="MATMLYTVLAASGGWVAGQEVAIGSQIALTDVEARYELDLGTIAP
FT                   TGQEPPQPPPPPALLDGDLIETRRGSLDRAIVIAALEVFLTRVGGGIAQYVDARDAALV
FT                   ASLSAQGATLAGLRAALVGTADAQHDTLGKLQTALAGLSATLADKAAASELAALDARTN
FT                   HLDNTSDATKAQPGNPIGDAIAAAALKGRLLAKTTAPALGDLADGQWSLICDTSTTPPT
FT                   FVLAARVGGALSTFVLNPPAA"
     atggcgacca tgctttacac cgtgctcgcc gcgtcgggcg gctgggtcgc cggccaggag        60
     gtcgcgatcg gctcccagat cgcgctgacc gacgtggagg cgcgctacga gctcgacctc       120
     ggcaccatcg cgccgaccgg ccaggagccg ccgcagccgc ccccgccgcc ggccttgctc       180
     gacggggacc tgatcgagac gcggcgcggg tcgctcgacc gggctatcgt gatcgcggcc       240
     ctggaggtgt ttctgacccg cgtcggcggc gggatcgcgc agtacgttga cgcgcgcgac       300
     gccgcgctcg tggccagcct ctcggcccaa ggcgccacgc tcgccgggct gcgggctgcc       360
     ctcgtcggca ccgccgacgc acagcacgac accctcggca agctgcagac ggcgctcgcg       420
     ggcctgtccg ccaccctggc ggacaaggcg gcggcgagcg aactcgctgc gctcgacgcg       480
     cgcacgaacc atctcgacaa cacctcggac gcgaccaagg cccagcccgg caatccgatc       540
     ggggacgcca tcgcggcggc cgccctcaag gggcgattgc tcgccaagac gacagcgccg       600
     gcgctcggcg acctcgcgga cgggcagtgg tcactcatct gcgacacctc gacgacgccc       660
     ccgaccttcg tactcgccgc tcgggtcggc ggtgcgctct cgactttcgt gctcaacccg       720
     cccgctgcct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page