(data stored in ACNUC7421 zone)

EMBL: CP001349.PE555

CP001349.PE555       Location/Qualifiers
FT   CDS_pept        complement(634406..635434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0570"
FT                   /product="late control D family protein"
FT                   /note="PFAM: late control D family protein; KEGG:
FT                   met:M446_4124 late control D family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55607"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN5"
FT                   /inference="protein motif:PFAM:PF05954"
FT                   /protein_id="ACL55607.1"
FT                   /translation="MSLATSWRVLVNGLDASDRMNPYIESIETTDNAGGKSDSASIVFD
FT                   DTDGQVKLPTKGDPVEIELEGVSVFKGVVDSAESSAARGSGMQLTVSCKSVDKRGKVKE
FT                   RLHKHKDDATLEDFLKDAAKAAGLKDVKVDKSFASIKRPYWSTDGRTFLQLGQELAEEL
FT                   GATFKIQGDTAVFAKRGQGGTPGGGTMPTVRAIRRQNLVSWRITPKETRPRYAKARVRW
FT                   YDRKEAKWKQEDVEIGNAPGAPEVLDLPAAPRATQDHAKDAGKGRKTESEREGGSGEVT
FT                   LLLAVEARAEGTCEVIGTRPGVDGSYRIESVTHKVSRSGAETTLSIKQPQGSAGSDDRS
FT                   AE"
     atgtcgctcg caacgtcgtg gcgcgttctc gtcaatgggc tcgacgcttc cgaccgcatg        60
     aacccgtata tcgagagcat cgagaccacg gacaacgcgg gcggcaagtc cgacagcgcg       120
     agcatcgtct tcgacgatac ggacgggcag gtgaagctcc cgaccaaggg agacccggtc       180
     gagatcgagt tggagggggt ctcggtcttc aagggcgtgg tcgacagcgc cgagagcagc       240
     gccgcccgcg gctcgggcat gcagctcacc gtgagctgca agagcgtcga caagcggggc       300
     aaggtcaagg agcgcctgca caagcacaag gacgacgcga ccctggaaga tttcctcaag       360
     gacgccgcga aggcggcggg cctgaaggac gtcaaggtcg acaagagctt cgcgtcgatc       420
     aagcgcccgt actggtcgac ggacggcagg acctttcttc agcttgggca ggagctggcg       480
     gaggagctgg gcgcaacatt caaaatccag ggcgacacgg ccgtgttcgc gaagcgcggg       540
     cagggcggca cgcccggcgg cggtacgatg ccgaccgtcc gggctatccg ccgccagaac       600
     ctcgtcagct ggcggatcac gcccaaggag acgcgcccgc gctacgccaa ggccagggtg       660
     cgttggtacg accgcaagga agccaagtgg aagcaggaag acgtcgagat cggcaacgcg       720
     cccggcgcgc ccgaggtgct cgacctgccg gcggccccgc gcgcgaccca ggaccacgcc       780
     aaggacgccg gcaagggccg caagacggaa tccgagcgcg agggtggctc gggcgaagtc       840
     acgctgctgc tcgccgtcga ggcccgcgcc gagggcacct gcgaggtcat cggcacgcgg       900
     cccggagtcg acggcagcta ccggatcgag agcgtcaccc acaaggtcag ccggtccggc       960
     gccgagacca cgctgagcat caagcagccg caagggtcgg ccggcagcga cgaccgctcg      1020
     gccgaatag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page