(data stored in ACNUC7421 zone)

EMBL: CP001349.PE557

CP001349.PE557       Location/Qualifiers
FT   CDS_pept        complement(635679..636116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0572"
FT                   /product="P2 GpU family protein"
FT                   /note="KEGG: met:M446_4126 P2 GpU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55609"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN7"
FT                   /inference="similar to AA sequence:KEGG:M446_4126"
FT                   /protein_id="ACL55609.1"
FT                   /translation="MQYSVGVLTFDTFPFSVTGAEREDGEDYAKHDLLNRRRGYEHEGP
FT                   ADDVLTLSGEFLPFHIGGMSELELARDLKNSGSPQYVMRGDGYALGWYVITSIKDSHAD
FT                   AIAPDGVAYKVKYEIKLERVDDPGEDAGAGLIASLVASLFG"
     gtgcagtatt ccgtgggcgt actgactttc gacaccttcc cgttctcggt tacgggggcc        60
     gagcgcgagg atggcgagga ctacgccaag cacgacctgc tcaaccgccg ccgggggtat       120
     gagcacgagg gacccgccga cgacgtgctc acgctgtcgg gcgagttcct gccctttcac       180
     atcggcggca tgtccgagct ggaactggcg cgagatctca agaacagcgg ctcgccgcag       240
     tatgtcatgc gaggcgacgg ctatgccctc ggttggtacg tcatcacgtc catcaaggac       300
     agccatgccg acgcgattgc cccggacggc gtcgcctaca aggtcaagta cgagatcaag       360
     ctggagcgcg tggacgaccc gggcgaggac gcgggcgctg gcctgatcgc ctccctcgtc       420
     gcatccctgt tcgggtga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page