(data stored in ACNUC7421 zone)

EMBL: CP001349.PE558

CP001349.PE558       Location/Qualifiers
FT   CDS_pept        complement(636135..640766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0573"
FT                   /product="TP901 family phage tail tape measure protein"
FT                   /note="KEGG: met:M446_4127 TP901 family phage tail tape
FT                   measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55610"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN8"
FT                   /inference="similar to AA sequence:KEGG:M446_4127"
FT                   /protein_id="ACL55610.1"
FT                   /translation="MVSKTASLIIRLTDDVSGPAGKAAQALKGLSTAGDGLSRLKNAAS
FT                   GLDQLGAKMRQAKIEVERAGKELAAAEKRVAFFRASRERGSHNYPAFEASGLVAEAEAR
FT                   LKAAKRAHAAAERQMAATRAIFVDQKRTVASLTASLSAASGGLKDLRSAETNVAGAAAQ
FT                   TTGALSRQTGVLSSVAGGARTAARAYRDLAAGMSEAGRKALATVEANRRLVEGMSAPAR
FT                   AAAAAAEAHRKAAMQGRADRAASRREALETIGAGAGLIAAHRGKAIGLQAVQSAASMDY
FT                   ATRYQHVATDVSEEDQRRLLIPQAKRIGQETKFSNEDIVHAQTATMQGLPFKDPALKAR
FT                   VGEALVDQARHYAVIMQSDMTRASEGIRSFLQNTNKDISTPEKSLAEAQRGTNLIVKMA
FT                   KLGGMSDEDAQQFIKFGFPTGTQAGLSDVTLAALGASGRRAGLRGDELGVFARAMASKL
FT                   VAPTSKGLDALTAAGIHYNRYTTMPGGLNVDNLEAFSKRRFGKGFTEDQRTRLADLLEN
FT                   SEVVGERDEFTKQVSAIVAEGFGKGKSGKTKAQDVQKIAKMVGDFHKLSVESVDTEGLL
FT                   RAIFSNPKMTAALLNAFFTDKHGGKAGMIAPKMAQFNQDVEELKKIGEDPLFAERKSKY
FT                   MTQGLGGSIDNLKGSFETMVLSIGQANEGLIRFAADGLAKGTDLFSNLSQTQQQILSLV
FT                   GGGAAVAGGVWGTATLMKNLLGFGASAQALTGSAGLLSKSALELSAAAATLGGKGVLPE
FT                   VAKTAAPVAAGAAGVTAGAIAGAVAAGVGTAALVYAAGGRYQPEEVVRMRDELSELNKR
FT                   LERQNESVYRQQSQGDDATAEIARRDATLARIKELTAALEKAATAQGTETKGEEGPRAG
FT                   LKLSEAAREALDARKAGAAVQAPPETVSAPAPSVRPPEVSGVTDAATKAGGEAPKPAEG
FT                   ASQAAPAAAPVMAPTVRAPAPPARPPELGQAPAPLPPARSPEMGLPPDHAAAIQAATSA
FT                   LATYRAELAGIERQLAGLQASGEAAFSPDLSGLEARKAEVEATIRGLEAKLQAIKPAST
FT                   DMAPPDFAAAIKAAEKAGADAGEGITDGIRAQIPAAGRAGTEAGQNAGQGVAKGIEQEG
FT                   PKAVDKAKTLWERIKDVFAEGVNIPINFEGGSGAAAITKASYVSLPGGAGADLGRPRSR
FT                   LGSIAHRGGASAGAPGPAVSPQAEFGPGVDAARLPAGMRNNNPGNIKFTRVGAFGTVIG
FT                   PSRNTDQGDPQAVFANAEDGMRALVDLARRKWEGGRQTVADLIARRGGWTPGNHQAAAN
FT                   IARGAGVGLHERIDLSDDAVMQRFVRALITQEHGPAGRLYSDELIRKALRPREAPAAQA
FT                   AAKAPERPAIPGMMPGAERVNPGYGKPLHQGGTGLSRYSDEDLRRMRERQDALDRIKAT
FT                   GEGITPEQAEAARRRIQERYTPRPASPEATPGLTRPAPGVTPSGVPAITPKADPNGLDA
FT                   LGTKADGAKDKLAALSGVSISPQVSTGNLDALIAKANQALAALQRIPGAVASANASIAS
FT                   VSPAGAGGGSTGKVRDALSDNFA"
     atggtgagca agacagcctc tctcatcatc cgcctgaccg acgacgttag cggaccggcc        60
     gggaaggcgg cgcaggcgct caaagggctc agcacggccg gcgacggact ctcgcgcttg       120
     aagaacgcgg cgtccgggct cgatcaactc ggcgccaaga tgcggcaggc caagatcgag       180
     gtggagcggg cggggaagga acttgcggcg gccgagaagc gcgtcgcgtt cttccgggcg       240
     agcagggagc ggggctcgca caactatccg gccttcgagg cctcgggcct cgtcgcagag       300
     gccgaggcgc gcctgaaggc agccaagcgc gcgcatgcgg cggccgaacg ccagatggcg       360
     gcgacgcgcg cgatcttcgt cgatcagaag cggacggtgg cgagcctgac cgccagcttg       420
     tcggcagcga gcggcgggct caaggacctg cgctcggccg agacgaacgt cgcgggcgcg       480
     gccgcacaga cgaccggcgc actctcacgc cagacgggcg tcctctcgtc cgttgccggc       540
     ggcgcgcgca cggctgcccg cgcctaccgc gacctcgccg ccggcatgag cgaggcgggg       600
     cgcaaggcgc tcgccaccgt cgaggcgaat cggcgcctcg ttgagggtat gagcgccccg       660
     gcgcgcgctg ccgcggctgc ggccgaggcc catcgcaagg cggccatgca gggtcgcgcc       720
     gaccgggccg cgtcccgacg cgaggcgctg gagaccatcg gcgcgggcgc aggcttgatc       780
     gcggcacacc gggggaaggc catcggtctc caggccgtgc agtcggccgc gtcgatggac       840
     tatgcgacgc gctaccagca cgtcgccacc gacgtgagcg aggaggatca gcgccgcctg       900
     ctcatcccgc aggccaagcg gatcggccag gagaccaagt tctcgaacga ggacatcgtc       960
     cacgcccaga ccgccaccat gcagggcctg cccttcaagg accctgcgct caaggcgcga      1020
     gtgggcgagg cactggtgga tcaggcgcgg cactacgccg tgatcatgca gtccgacatg      1080
     acgcgcgcgt cggagggcat ccggtcgttc ctccagaaca cgaacaagga catctcgacg      1140
     cccgagaaat ccctcgcgga ggcgcagcgg ggcacgaatc tgatcgtcaa gatggcgaag      1200
     ctcggcggca tgtccgacga ggatgcccag cagttcatca agttcggctt cccgaccggc      1260
     actcaggccg ggctctcgga cgtcacgctc gccgccctcg gcgcgagcgg acgccgcgcc      1320
     ggcctgcgcg gcgatgagct tggcgtcttc gctcgggcga tggcctcaaa gctggtcgcg      1380
     ccgacctcga aggggctcga tgccctgacg gccgcgggca tccactacaa ccggtacacg      1440
     accatgccgg gcggtctgaa cgtcgacaat ctggaggcgt tcagcaagcg gcggttcgga      1500
     aaggggttca ccgaagacca gcgcacgcgc ctcgccgacc tgctggaaaa ctccgaggtc      1560
     gtcggcgagc gcgatgagtt caccaagcag gtctcggcca tcgtcgcgga ggggttcggc      1620
     aagggcaaga gtggcaagac caaagcgcag gacgtgcaga agatcgccaa gatggtcggc      1680
     gacttccata aactgtccgt ggagagcgtc gatacggaag gattgctgcg cgcgatcttc      1740
     agcaatccga agatgacggc cgctctgctc aacgccttct ttacggacaa gcatggcggc      1800
     aaggccggca tgattgcgcc gaagatggcg cagttcaatc aggacgtcga ggagctgaag      1860
     aagatcggcg aggatccgct gttcgcagag aggaagtcga aatacatgac gcagggcctc      1920
     ggcggctcga tcgacaacct gaaggggtcg ttcgagacga tggtcctcag catcggacag      1980
     gcgaatgagg gcctgatccg cttcgcggcg gacggcctgg cgaagggcac ggacctgttc      2040
     tcgaacctgt cgcagacgca gcagcagatc ctctcgctgg tgggcggcgg cgcggcggtg      2100
     gcgggcggcg tctggggtac ggcgacgctg atgaagaacc tgctcggctt tggcgccagc      2160
     gcgcaggcgc tcaccgggtc cgcgggtctg ctctcgaaat ccgcccttga gctgagcgcg      2220
     gccgcggcga cgctcggcgg caagggcgtc ctgccggagg tcgccaagac tgccgccccg      2280
     gttgcggcgg gcgcggctgg cgtcacggcc ggcgcgattg caggagccgt ggcggccggc      2340
     gtcggaaccg ccgcgctggt ctatgcggcc ggcggccggt atcagccgga agaagtcgtg      2400
     cggatgcgcg acgagctgtc cgagctgaac aagcggctcg agcggcagaa cgagagcgtc      2460
     taccgccagc agtctcaggg cgatgacgcg acggccgaga tcgcgcgccg cgacgccacc      2520
     ctggcccgca tcaaggagct gaccgccgcc ctggaaaagg cggcgacggc gcaggggaca      2580
     gagaccaagg gcgaggaggg tccgcgcgcc gggctcaagc tgagcgaggc ggcccgcgag      2640
     gcgctcgatg cgcgcaaggc gggcgccgcg gtccaagcgc ctccagagac cgtgtcggca      2700
     ccggccccgt cggtccgccc gccggaggtc tccggagtga cggacgcagc taccaaggcc      2760
     ggcggcgagg cccccaagcc cgccgagggc gcgtcgcagg cggctccggc cgccgcgccc      2820
     gtgatggcgc cgactgtgcg tgcgccagct ccccctgcgc gtccgcccga acttggccaa      2880
     gcccccgcac cgctcccgcc cgcgcgctcg ccggagatgg gcttgccgcc ggaccacgcc      2940
     gcggcaatcc aggccgccac gtccgcgctc gcgacctacc gcgcggagct cgccgggatc      3000
     gagcgccagc tcgccggcct gcaggcctcg ggcgaggcgg cgttctcgcc cgacctgtcg      3060
     ggcctggagg cgcggaaggc cgaggtcgag gcgaccatcc gcggcctgga ggccaagctc      3120
     caggcgatca agccggcgtc gaccgatatg gcgccgccgg acttcgccgc cgcgatcaag      3180
     gccgccgaga aggccggggc ggacgcgggc gaggggatca ccgacggcat ccgcgcgcag      3240
     atccccgcgg ccggccgggc cggcacggaa gccgggcaga acgcgggcca gggtgtcgcg      3300
     aaggggatcg agcaggaagg ccccaaggcc gtcgacaagg ccaagaccct gtgggagcgg      3360
     atcaaggatg tgttcgccga gggggtgaac atcccgatca acttcgaggg cggcagcggc      3420
     gcggcggcga tcaccaaggc gagctatgtc tcgctgccgg gcggggcggg ggcggacttg      3480
     ggccgccccc gcagccgcct cggcagcatc gcgcaccgcg ggggagcatc tgcgggcgct      3540
     cccggacccg cggtctcgcc gcaggcggag ttcgggccgg gggtcgacgc cgcgcgcctg      3600
     ccggccggca tgcgcaacaa caacccgggc aacatcaagt tcacccgggt cggcgcattc      3660
     ggcacggtga tcggcccctc gcgcaacacc gatcagggtg accctcaggc ggtgtttgcc      3720
     aacgccgaag acggcatgcg ggcgctggtc gatctcgccc ggcgcaagtg ggagggcggg      3780
     cgccagacgg tcgccgatct catcgcgcgc cgtggcggct ggacgccggg caaccatcag      3840
     gcggcggcga acatcgcccg gggcgccggg gttgggctgc atgagcgcat cgacctgtcg      3900
     gacgatgccg tgatgcagcg gttcgtgcgc gccctcatca cgcaggagca cgggccggcg      3960
     ggccggctct attccgacga gttgatccgc aaagcgctca ggccgcgcga ggcgccggcg      4020
     gcgcaagcgg cggcgaaggc cccggagcgc cccgcgatcc ccggcatgat gccgggggcc      4080
     gagcgggtca atccgggtta cggcaagccg ctgcaccagg gcgggaccgg cctctcgcgc      4140
     tactccgacg aggatctgcg gcggatgcgc gagcgccagg atgcgttgga tcggatcaag      4200
     gcgaccggcg agggcatcac gcccgagcag gccgaggccg cccggcgtcg gatccaggag      4260
     cgctataccc cacgcccggc ctcgccggag gccaccccag gtctcacccg gcccgcgccc      4320
     ggcgtcacgc cgtccggcgt gccggcgatc acgcccaagg ccgatcccaa tggcctcgac      4380
     gcgctcggga ccaaggcgga cggcgccaag gacaagctgg cggcgctaag cggcgtcagc      4440
     atcagcccgc aggtctcgac gggcaacctg gatgccctga tcgcgaaggc gaaccaagcc      4500
     ctggcggcgc tccagcgcat cccgggggcg gtcgcctccg cgaacgcctc gatcgcgagc      4560
     gtcagccccg ccggggccgg cggcggctcg accggcaagg tgcgcgacgc gctcagtgac      4620
     aacttcgcat aa                                                          4632
//

If you have problems or comments...

PBIL Back to PBIL home page