(data stored in ACNUC7421 zone)

EMBL: CP001349.PE559

CP001349.PE559       Location/Qualifiers
FT   CDS_pept        640878..641309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_5180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55611"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN9"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5180"
FT                   /protein_id="ACL55611.1"
FT                   /translation="MLSGLVLLALAEIGTGAPTVQIVTPRKLIDNPRSYLHQKTLVQNI
FT                   HCIDVPRGRLICIVPIGGQIIRLEGSALGAKTPLSIAERLTGDYKGTANISNAACVVDV
FT                   EIEPTSVVKDMLDTPSGSMPLLTVYSPLIEMYRPRGRER"
     atgctctctg ggcttgtcct gctggcgctt gccgagatcg gcactggcgc gccaacggta        60
     caaattgtaa ctcctagaaa attgatagac aatccaagat catatctgca tcagaagact       120
     ttagtccaaa atattcactg cattgatgtg ccaagggggc gcctcatctg tattgttccc       180
     atcggcggac aaattatccg acttgagggg agtgcactgg gggcgaagac tccacttagt       240
     atcgctgagc ggctaaccgg agattacaaa ggtaccgcga acatcagcaa tgcggcatgc       300
     gtggtcgatg tggagatcga gcccaccagc gtcgtaaagg atatgcttga tacgccttca       360
     ggatcgatgc cgcttcttac ggtctactca ccgctgatcg agatgtatcg gccgcgaggg       420
     cgggagcgtt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page