(data stored in ACNUC7421 zone)

EMBL: CP001349.PE56

CP001349.PE56        Location/Qualifiers
FT   CDS_pept        63612..64289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0057"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: met:M446_0057 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55108"
FT                   /db_xref="GOA:B8IU63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU63"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55108.1"
FT                   /translation="MRILLVEDTQDVGEAIVARLRTLGHAVDWERDGAMGDAVLEVQPY
FT                   DLVILDVNLPGLDGFAILKRMRARRGRTPVLVLTARSEVDDRVGALDLGADDYLVKPFD
FT                   FRELEARVRALLRRHSGHADNAIACGNLSLDRAARSASVGGQPLDLTRREWTLIEILAA
FT                   RPGRIFGKAELLDRLSTFEEEPSENALEQIVARLRRKLAQAGAEPEIRTLRGLGYQVVC
FT                   PEP"
     atgcggatcc tgctcgtgga ggatacgcag gacgtcggcg aggccatcgt ggcgcgcctg        60
     cggacgctcg gccacgcggt cgactgggag cgcgacgggg caatgggcga cgcggtgctg       120
     gaggtccagc cctacgacct cgtgatcctc gacgtgaacc tgccggggct cgacggcttt       180
     gccatcctga agcggatgcg ggcgcgccgg ggccgcacgc ccgtcctcgt cctcaccgcc       240
     cgctccgagg tcgacgaccg ggtcggcgcc ctcgatctcg gcgccgacga ctatctcgtg       300
     aagcccttcg attttcgcga gctggaggcc cgggtgcggg cgctgctgcg gcggcacagc       360
     gggcatgccg acaacgccat cgcgtgcggc aatctcagcc tcgaccgggc cgcccgcagc       420
     gccagcgtcg gcggccagcc cctcgacctc acccgccgcg aatggacgct gatcgagatc       480
     ctggcggccc ggcccgggcg catcttcggc aaggcggagc tgctcgaccg cctctcgacc       540
     ttcgaggagg agccgagcga gaacgccctc gagcagatcg tcgcccgcct gcgccgcaag       600
     ctcgcgcagg cgggcgctga gcccgagatc cgcaccttgc gcggactcgg ctatcaggtc       660
     gtgtgtcccg agccgtga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page