(data stored in ACNUC7421 zone)

EMBL: CP001349.PE560

CP001349.PE560       Location/Qualifiers
FT   CDS_pept        complement(641317..642204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0575"
FT                   /product="prophage antirepressor"
FT                   /note="PFAM: BRO domain protein; KEGG: ecv:APECO1_4056
FT                   putative anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55612"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP0"
FT                   /inference="protein motif:PFAM:PF02498"
FT                   /protein_id="ACL55612.1"
FT                   /translation="MNALQTFDFESQAVRSFERDGQVWFVAADVCRALGLTNSRMALQA
FT                   LDDDEKGVSSIYTPGGRQEMAIISEPGLYTIILRCREATKPGSLPHRFRKWVTGEVLPA
FT                   LRKTGRYSMRAGEGEASTFDYERIGAMARLVSEARHVYGREAARALWERLPLPQVPNPA
FT                   ARMMYEGRENDGPGCLAHLMCRAAGNGQSLRTVIEAAWRDGPKRSWLFERGIKVVLDAR
FT                   DRRGDHIAIADRHPFLQQVFAETCWADDWFLPLLSVEGAKASRRPMEFGHGVEEKSLGR
FT                   VRAVLIPKLQVQLG"
     atgaacgcgt tgcagacctt tgatttcgag agccaagcgg tccgctcctt cgagcgggac        60
     gggcaggtct ggttcgtggc ggcggacgtg tgtcgggcgc tcggcttgac gaactcgcga       120
     atggcgcttc aggcgctcga tgacgacgag aagggtgtaa gttcaattta cacccccggc       180
     ggcagacagg agatggccat catctcggaa cccggcctct acaccatcat cctccgctgc       240
     cgcgaggcga caaagcccgg ctccctcccg caccgattcc gcaagtgggt cacgggtgag       300
     gtcctgccgg cgctgcgcaa gacagggcga tacagcatgc gggccgggga gggagaggcg       360
     tccaccttcg actatgagcg catcggcgct atggcccggc tggtgagtga ggcgcgccac       420
     gtctacggcc gcgaagcggc gcgcgccctg tgggagcgcc tgccgctgcc gcaggtgccg       480
     aaccccgcgg cgcggatgat gtacgaagga cgcgagaacg atgggcctgg ctgcctcgcc       540
     catctgatgt gccgcgccgc cgggaacgga cagagccttc ggaccgtgat cgaggcggcg       600
     tggcgggatg gcccgaagcg ctcctggttg ttcgagcgcg gaatcaaggt agtgctcgat       660
     gcgcgggatc ggcgcggcga ccacatcgcg atcgccgaca gacacccctt cctgcagcag       720
     gtcttcgccg agacctgctg ggccgacgat tggttcctgc cgctcctcag cgtcgagggt       780
     gccaaggcga gccggcggcc gatggagttc gggcacggcg tcgaggagaa gtcgctcggg       840
     cgggtccggg cggtgctgat tccgaagctt caggtgcagt tggggtag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page