(data stored in ACNUC7421 zone)

EMBL: CP001349.PE561

CP001349.PE561       Location/Qualifiers
FT   CDS_pept        complement(642375..642725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_1869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55613"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55613.1"
FT                   /translation="MPQASGDDSTRPTAMHPRRRLARRRLIEDTIETLIAYLDEADGDP
FT                   DLEDEGDDEPSLGSPERTAEFGVTVIDGDRYHILSTSQIHWGDGGTMDREVEDEHDEPD
FT                   GDEFDDDGLDER"
     atgccacagg cttccgggga cgatagcacg cgcccaaccg ccatgcatcc gcgccgccgc        60
     ttggcgcgtc gccgtctgat cgaggacacg attgagaccc tgatcgccta tctggacgag       120
     gccgacggcg accccgacct ggaggacgag ggcgacgacg agccctccct cggctccccg       180
     gagcgcacgg cggagttcgg ggtgaccgtc atcgacggcg accgctacca catcctcagc       240
     acgtcgcaga tccactgggg ggatggcggc acgatggacc gcgaggtgga ggacgagcac       300
     gacgagccgg acggcgacga gttcgacgac gacggcttgg acgaacgctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page