(data stored in ACNUC7421 zone)

EMBL: CP001349.PE562

CP001349.PE562       Location/Qualifiers
FT   CDS_pept        complement(643257..643793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55614"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP2"
FT                   /inference="similar to AA sequence:KEGG:M446_4128"
FT                   /protein_id="ACL55614.1"
FT                   /translation="MLSFSQLVTNFEPAGKAAPEAPQAAPAPAGAKTPRRRKSPPTAAP
FT                   SAAQAAPAPEAPPPPEPPVFVGGKPRSAAFPLDFPVQFQGRVYDTVVMRRPTAREVAEF
FT                   YDALAETGFKGFPIFYTPEGDRIPFEVIENLDPDDDDRIMERLMDFLPRRMLPHTETPN
FT                   SVSTPASGETTAPTS"
     atgctcagct tcagtcagct cgtgaccaac ttcgagccgg ccggcaaggc cgcgccggaa        60
     gccccacagg ccgctccggc gcccgccggg gccaaaaccc cgcgccgccg caaatctccg       120
     ccgacggcag ccccaagtgc agcccaggcc gcccctgcgc ccgaggcgcc cccgccgccc       180
     gaacctccgg tcttcgtcgg tggcaaaccg cgatcggcgg cgttcccgct cgatttcccg       240
     gtccagttcc aggggcgcgt ctacgacacg gtcgtgatgc gccgcccgac cgcccgcgag       300
     gttgccgaat tctacgacgc actcgcggag acggggttca agggcttccc tatcttctac       360
     acgcccgaag gggaccgcat ccccttcgag gtgatcgaga atctggaccc cgacgacgac       420
     gaccggatca tggagcggct gatggatttt ttgccgcgcc ggatgctgcc gcacacggag       480
     acccccaaca gcgtgtcgac ccccgccagt ggcgagacta ccgcgccgac atcttga          537
//

If you have problems or comments...

PBIL Back to PBIL home page