(data stored in ACNUC7421 zone)

EMBL: CP001349.PE563

CP001349.PE563       Location/Qualifiers
FT   CDS_pept        complement(643852..644379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0578"
FT                   /product="major tail tube protein"
FT                   /note="PFAM: major tail tube protein; KEGG: met:M446_4129
FT                   major tail tube protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55615"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP3"
FT                   /inference="protein motif:PFAM:PF04985"
FT                   /protein_id="ACL55615.1"
FT                   /translation="MAQDILIIEEVDVRREDDAEDTRVFTINKMGLPALKRKTSEHTPG
FT                   GGIGTVNYALPMIDALEPTFAVKGVDLDVLRKYGFTSGTNDKWIFAASLRNKKTNVLLP
FT                   VRATIQGIICEWSPGEHTPGELLDCDHTMQEVKYYKLVVNNERIFEWDFYGRKWFNGDT
FT                   DVFAEYRATLGA"
     gtggctcagg atattctcat catcgaagag gtcgacgtgc gtcgcgagga cgacgccgaa        60
     gacacgcgcg tgttcacgat caacaagatg ggcttgccgg cgctcaagcg gaagacgagc       120
     gagcacaccc ccggcggcgg catcggcacc gtgaactatg ccctgccgat gatcgatgcg       180
     ctcgaaccca cgttcgcggt caagggcgtc gacctcgacg ttctgcggaa gtacgggttt       240
     acgagcggca caaacgacaa gtggattttc gcagccagcc tgcgcaacaa gaagacgaac       300
     gtgctcttgc cggtccgcgc gacgattcag gggatcatct gcgagtggtc acccggcgaa       360
     catacgcccg gcgagctgct cgactgcgat cacacgatgc aagaggtcaa gtattacaag       420
     ctcgtcgtta acaatgagcg gatcttcgag tgggacttct acggccgcaa gtggttcaac       480
     ggcgacacgg acgtcttcgc cgagtaccgc gccaccctgg gcgcctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page