(data stored in ACNUC7421 zone)

EMBL: CP001349.PE564

CP001349.PE564       Location/Qualifiers
FT   CDS_pept        complement(644462..645748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55616"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP4"
FT                   /inference="similar to AA sequence:KEGG:M446_4130"
FT                   /protein_id="ACL55616.1"
FT                   /translation="MTAPTFGYINTRPKDDPVVVAGADFSKVGMCSTSEDADATVFPPD
FT                   EPVRFTSTDPAYLSKLGSGYLYDAVVNINAQLEGKGADVTVVRVPEGTSTDPTTKLEQT
FT                   FANIIGTAGAQTGLHALRAATDHVKATSRLVGVPGYLAQQLDGPTVANPIVAALPEHLD
FT                   ALRAVCVVDVAPGTREAAIAARETMSSMRLIPLGVGVRAYKTINSTATLTTMPGSPCVL
FT                   GLFVRQDNNNGGKPFDTIANLPLYGIADLSRPIAFSLTDGSVEGQTLLAADVSIIVRGE
FT                   SANVDSIADGGFVFIGTESAEISAAWTQFHQVRGQDYIDVEYQKITRQYLGRRLYPRLV
FT                   ESWLGSINNMLRNHVNNDPPDILGYNLVFPKGLNSDDELTLGHLHIQSYIQQAPAFTVA
FT                   QNDVRQYRPALAALVAAVQAGTGPMTATV"
     atgaccgcgc ccaccttcgg ctacatcaac acgcgcccca aagatgatcc ggtcgttgtc        60
     gccggcgcgg atttctccaa ggtcggtatg tgctcgacct ccgaggacgc cgacgccacg       120
     gtgttcccgc ccgatgagcc ggtgcggttc acctcgacgg atccggccta cctgtcgaag       180
     ctcggctctg gatacctcta cgacgccgtc gtgaacatca acgcccaact cgaaggcaag       240
     ggcgccgacg tgaccgtcgt gcgcgtgccg gagggcacaa gcaccgatcc gaccaccaag       300
     ctcgagcaga ccttcgccaa catcatcggc acggccgggg cgcagaccgg gctccacgcc       360
     cttcgggccg cgaccgatca cgtcaaggcg acctcgcggc tcgtcggcgt gcccggctac       420
     ctcgcacagc agctcgacgg cccgaccgtg gccaacccga tcgtcgcggc cctgcccgag       480
     cacctggatg ccctgcgcgc cgtgtgcgtc gtcgacgttg cgcccggcac cagggaagcg       540
     gcaattgcgg cgcgtgagac catgtcctcg atgcgcctga tcccgctcgg ggtcggggta       600
     cgcgcttaca agacgatcaa cagcaccgcg acgctgacga ccatgccggg ctcgccctgc       660
     gtcctgggcc tgtttgtgcg ccaggacaat aacaacggcg gcaagccctt cgacacgatc       720
     gccaacctgc cgctctatgg catcgcggac ctctcgcgcc cgatcgcctt ctcgctgacc       780
     gacggctcgg tggaggggca gacgctgctc gcggcggacg tttcgataat cgtgcgcggc       840
     gagtccgcga acgtcgacag catcgcggac ggcgggttcg tgttcattgg caccgagtcg       900
     gccgagatct cggccgcctg gacgcagttc catcaggtcc gcggccagga ctacatcgat       960
     gtcgaatacc agaagatcac ccgccagtac ctcggccggc gcctgtatcc gcgccttgtc      1020
     gagagctggc tgggctcgat caacaacatg ctacgcaatc acgtcaacaa tgatccgccg      1080
     gacattctcg gctacaacct tgtcttcccg aaggggctca actcggacga cgagctgacc      1140
     ctcggccacc tgcacatcca gagctatatc cagcaggccc cggctttcac ggtcgcccag      1200
     aacgacgtgc gccagtaccg gcctgccctg gcagccctgg tcgccgccgt ccaggccggc      1260
     accgggccga tgaccgccac ggtctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page