(data stored in ACNUC7421 zone)

EMBL: CP001349.PE565

CP001349.PE565       Location/Qualifiers
FT   CDS_pept        complement(645824..646333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55617"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP5"
FT                   /inference="similar to AA sequence:KEGG:M446_4131"
FT                   /protein_id="ACL55617.1"
FT                   /translation="MTQPVLSGVAIDLTHAGLSYRGHDVPALRRAGVPEPVILAAVKDL
FT                   LQAGIDADAEALRARLASPGAGQAMEYQEAAAQAAAALTAPGSATADAYPMLAATVGID
FT                   IDPETGAPAVDVLGVARAVAAASARWLTAGAAIRKARLTGKAAVAAAATPEAAQAARVE
FT                   IIWPTF"
     atgacgcaac ccgtcctttc gggcgtggcg atcgacctga cgcatgctgg cctctcctac        60
     cgcggccacg acgtgccggc cctgcgccgc gccggcgtgc ccgagccggt gatcctcgca       120
     gccgtcaagg acctcctgca ggccggcatc gacgccgacg ccgaggctct gcgcgcccgc       180
     ctcgcctcgc ccggcgccgg gcaggcgatg gagtaccagg aggccgccgc ccaggctgcg       240
     gcggcgctca ccgcgcccgg cagtgccacc gcggacgcct acccgatgct cgcggctacg       300
     gtcggcatcg acatcgaccc ggagaccggc gcgccggcgg tcgacgtgct cggcgtcgcc       360
     cgcgccgtcg ccgcggcctc cgcgcgctgg ctcacggccg gcgcggcgat ccgcaaggcc       420
     cggctcaccg gcaaggcggc tgtcgccgcc gccgcgacgc ccgaagccgc ccaggccgcc       480
     cgcgtggaga tcatctggcc gacattctga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page