(data stored in ACNUC7421 zone)

EMBL: CP001349.PE566

CP001349.PE566       Location/Qualifiers
FT   CDS_pept        complement(646364..647128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55618"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP6"
FT                   /inference="similar to AA sequence:KEGG:M446_4132"
FT                   /protein_id="ACL55618.1"
FT                   /translation="MTTVVEGLENATTALEQAVADVLGLKSQLLAPYNQNVTQTTNIVN
FT                   QFINRSAYEVVWIDEIDGSDTNDGKTADTPKRSLDAAIAAMGMSATEFRLLSDVTLKQK
FT                   TNLYANVIFSGVQKSAAAPGYIPFNRRMSFLGTAENSPQPGVGTFCAGLFVYTANVQFG
FT                   FIDFALPDVPAGIGYPYAFSAQAQASFVVYNTTLTVGSPAAGSLFGSILGRVTASLSLV
FT                   LGTGAAGHVFDGVAAGGNPNLAWKYDTNITSA"
     atgacgacag tcgttgaagg tctcgaaaac gccacgacgg cgcttgagca agccgtcgcg        60
     gatgtgcttg gtctgaaatc gcaactgctc gcgccctata atcagaacgt gacgcaaacg       120
     acgaacatcg tcaatcaatt catcaaccgc tccgcttacg aggtcgtctg gatcgacgag       180
     atcgacggct cggacaccaa cgacggcaag acagccgaca cgcccaagcg ctcgctcgac       240
     gcggccatcg ccgccatggg gatgagcgcg accgagttcc gtcttctctc cgacgtcacg       300
     ctgaagcaga agaccaactt atacgccaac gtgattttca gcggcgtgca gaaatcagcg       360
     gcggcgccgg gctatatccc gttcaacaga cgcatgtcat tcctcggcac ggccgagaat       420
     tcgccgcagc ccggggttgg aacgttctgt gcggggctgt ttgtctatac ggcaaatgtt       480
     cagttcggct ttatcgactt cgcgttgccg gacgttccag ccgggattgg ctatccgtat       540
     gccttctcag cccaggcgca ggcgagcttc gtcgtctaca acacgaccct cacggtcggg       600
     tcgcctgcgg ccggctcgct gttcggtagt atcttgggcc gcgtcaccgc aagcctctcc       660
     ctcgtgctcg gcacgggggc ggccgggcat gtcttcgacg gggtcgctgc aggcggaaat       720
     cccaacttgg cctggaagta cgacaccaac atcacctcgg cctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page