(data stored in ACNUC7421 zone)

EMBL: CP001349.PE567

CP001349.PE567       Location/Qualifiers
FT   CDS_pept        complement(647141..647710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0582"
FT                   /product="pyocin R2_PP, tail fiber protein, putative"
FT                   /note="KEGG: met:M446_4133 pyocin R2_PP, tail fiber
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55619"
FT                   /db_xref="InterPro:IPR022225"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP7"
FT                   /inference="similar to AA sequence:KEGG:M446_4133"
FT                   /protein_id="ACL55619.1"
FT                   /translation="MSDPLVITLTRPGLAACVRAQGDGLQAVVDRVAVGRGLNTAGTYG
FT                   GYTPSKDATSLQNEVIRVPLISGSKLGAPGEARFRVLAEVPKTSSPAEYAIREVGFFLT
FT                   DGTLLALWSDPTPGFVLASKTALSDVALSLDLVLDQIPTGSLTLTVLDPEIPEWAATIA
FT                   ELLATAARTFSADLAQEQRMCAHGIY"
     atgtctgacc ctctcgtcat caccctgacg cgccccggcc tcgcggcctg cgtgcgcgcc        60
     caaggcgacg gcctccaggc cgtggtcgat cgcgtcgcgg tcgggcgcgg gctcaacacg       120
     gccggcacgt atggcggcta cacaccaagc aaggacgcga cgtcgctcca gaacgaggtg       180
     atccgcgtcc cgctgatctc gggctccaag ctcggtgctc cgggcgaggc ccgcttccgg       240
     gtcctggccg aggtccccaa gacctcatcg cccgccgagt atgcgatccg cgaggtcggg       300
     ttcttcctca cggacggcac cctgcttgcg ctgtggtcgg acccgacccc gggctttgtc       360
     ttggcgtcca agacggcgct ctcggacgtc gcgctctcgt tagacttggt gctcgatcag       420
     atcccgaccg gctctctcac gctcacggtg ctggacccgg agatccccga gtgggcagcg       480
     acgatcgccg aactgctcgc gaccgcagcc cgcaccttct ccgccgacct cgctcaagag       540
     cagcgcatgt gcgcccacgg catttattga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page