(data stored in ACNUC7421 zone)

EMBL: CP001349.PE568

CP001349.PE568       Location/Qualifiers
FT   CDS_pept        complement(647703..648389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0583"
FT                   /product="phage tail protein I"
FT                   /note="TIGRFAM: phage tail protein I; PFAM: tail protein I;
FT                   KEGG: met:M446_4134 phage tail protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55620"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP8"
FT                   /inference="protein motif:TFAM:TIGR01634"
FT                   /protein_id="ACL55620.1"
FT                   /translation="MADPVKRVNLLPQGATAREKAHADTDGRLDDRLAEARAITARKDP
FT                   TTCPVDLLPYLAWERSVDVWDPAWPEAVKRAVITAAPTVHAYKGTAYAVKTALAALQVQ
FT                   ADVTEWWQANPQGQPYTFSQPYTFSVVAHARSPIYGHVLLDARLIKVVFATVMRTKPLS
FT                   RAFDLTVAANMPGALGAAGIGVARSTVRVPVYADNSEAFASTLGAAGVAVARSMVRVAM
FT                   VSPPDV"
     atggctgacc cggtcaagcg cgtcaacctg ctcccgcagg gcgccacggc aagagagaag        60
     gcgcacgcgg atacggacgg gcggctcgat gaccgcctcg cagaggccag ggcgatcacg       120
     gcgcggaagg acccgaccac ctgcccggtc gacctgctgc cgtatctcgc ctgggagcgc       180
     tcggtcgacg tctgggaccc ggcgtggccg gaggcagtca agcgggcggt catcacggcg       240
     gcgccgaccg tccacgccta caagggcact gcctacgccg tcaaaaccgc gctcgcggcc       300
     ctccaggtcc aggcggatgt caccgagtgg tggcaggcaa acccgcaggg gcagccctat       360
     accttctcgc agccctatac cttctcggtc gtcgcgcatg cccgttctcc gatctacggg       420
     cacgtccttc tcgacgcccg cctgatcaag gtcgtgtttg cgaccgtgat gcggaccaag       480
     ccgctctcgc gcgcatttga cctgacggtc gccgcaaaca tgcccggcgc cctcggcgcg       540
     gccggcatcg gtgtcgcccg ctcgacggtc cgcgtcccgg tctacgcgga caacagcgaa       600
     gcctttgcct caaccctcgg tgccgcgggc gtggccgtcg cccgctcgat ggtccgcgtc       660
     gcaatggtga gcccgcccga tgtctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page