(data stored in ACNUC7421 zone)

EMBL: CP001349.PE57

CP001349.PE57        Location/Qualifiers
FT   CDS_pept        64286..65671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0058"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: met:M446_0058 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55109"
FT                   /db_xref="GOA:B8IU64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU64"
FT                   /inference="protein motif:PFAM:PF08521"
FT                   /protein_id="ACL55109.1"
FT                   /translation="MIGRTPSLFLRLVTVLGLVLAVGAALLLGAAWTSARLAADQAYDR
FT                   LLVGAALQIAETIASDGREITVDPPFSAFETLGLAPRDRIFYKVVDPSDGLLTGSPDLA
FT                   VPVDRARLGDGPLLLDATHRGEPVRVVVAGRYVPDIPKAGWAAVVVAQTREARNGLAGD
FT                   LTAKASLLVLTMSALALGAVTVAVRAALRPLAALERVLAGRGPNDLDPLDLAVPREIHL
FT                   LVTSINHFMDRLSGHMAIMRRFIADAAHQIRTPLAALGAQVDLLSAEGDEARRREQVIR
FT                   VQERTAELGRLTNQLLNHAMVIHRARSIPLAPVDLGAIARRTLIDAIPLAGTRPIDFGY
FT                   EGPDEPLPIRGDPIALREALANLIHNGIKHGAPGRLTVRTRRERDRITVEVVDDGAGIP
FT                   AAEWRRVREPFQAASGGAIGSGLGLAIAAEVTAAHGGEMRFESRSDEGFAVLLSFPAAE
FT                   AAP"
     gtgatcggcc gcacgccctc gctgttcctg cgcctcgtga cggtgctcgg gctggtcctg        60
     gcggtggggg ccgccctcct gctcggggcg gcctggacct cggcgcggct cgccgccgat       120
     caggcctatg accgcctcct cgtcggcgcg gcgctccaga tcgccgagac catcgcgagc       180
     gacgggcgcg agatcaccgt cgatcccccc ttctcggcct tcgagacgct cggcctcgcc       240
     ccgcgggacc gcatcttcta caaggtggtc gacccgtcgg acggccttct gaccgggagc       300
     cccgacctcg ccgtgccggt ggaccgggcg cggctcggcg acggccccct cctcctcgac       360
     gccacgcacc ggggcgagcc cgtgcgcgtc gtggtggcgg gccgctacgt gccggatatc       420
     ccgaaggccg gctgggcggc cgtggtcgtc gcccagacgc gggaggcccg caacgggctc       480
     gcgggcgacc tgaccgccaa ggcgagcctc ctcgtcctga cgatgagcgc ccttgccctc       540
     ggggccgtca cggtggcggt gcgggcggcc ctgcgcccgc tcgccgccct ggagcgcgtg       600
     ctggcggggc gcggccccaa cgacctcgat ccgctcgatc tggcggtccc gcgggagatc       660
     cacctcctgg tgacctcgat caatcacttc atggaccggc tctccgggca tatggcgatc       720
     atgcggcgct tcatcgccga cgcggcccac cagatccgca cgccgctcgc cgcgctcggc       780
     gcgcaggtcg atctcctgtc cgcggaaggc gacgaggcgc gccggcgcga gcaggtgatc       840
     cgcgtccagg agcgcaccgc ggagctcggg cgcctcacga accagctcct caaccacgcc       900
     atggtcatcc accgggcgcg ctccattccg ctcgcgccgg tcgatctcgg ggcgatcgcc       960
     cgccgcaccc tgatcgacgc gattcctctc gccggcacac gcccgatcga tttcggctac      1020
     gaggggccgg acgagccgct cccgatccgc ggcgatccga tcgcgttgcg cgaggccctg      1080
     gcgaatctca tccacaacgg catcaagcat ggggcgccgg gccggctgac ggtgcgcacc      1140
     cggcgcgagc gcgaccgcat caccgtcgag gtggtggatg acggcgcggg catcccggcg      1200
     gcggagtgga ggcgcgtgcg cgagccgttc caggccgcct ccggcggcgc gatcggctca      1260
     gggctgggcc tcgccatcgc ggccgaggtc acggcggcgc atgggggcga gatgcgcttc      1320
     gagtcgcgct ccgacgaggg cttcgccgtc ctcctctcct ttccggccgc ggaggcggcg      1380
     ccgtga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page