(data stored in ACNUC7421 zone)

EMBL: CP001349.PE570

CP001349.PE570       Location/Qualifiers
FT   CDS_pept        complement(648611..649132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0585"
FT                   /product="putative transposase of insertion sequence"
FT                   /note="KEGG: mrd:Mrad2831_5181 putative transposase of
FT                   insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55622"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAL5"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5181"
FT                   /protein_id="ACL55622.1"
FT                   /translation="MFLDETAATTSMVRRYGWAPRGERCRLAAPAGHWKTTTVIAGLRT
FT                   SGPDAIALLDGPVTGERFRAYVTDTLVPTLRPGDTVILDNLGAHKVAGVREAIAATGAR
FT                   LLYLPPYSPEFNPIEQAFAKLKALLRRAAARSVSELWAAIHQAFKCFSPAECRNYFTAA
FT                   GYEDDAYAST"
     gtgttcctgg atgagaccgc cgccaccacc agcatggtcc gccgctacgg ctgggccccg        60
     cgcggcgagc gttgccgcct cgcggcaccc gcagggcact ggaaaaccac cactgtgatt       120
     gccgggctgc gcacgagcgg gcctgacgcg atcgctctgc tggacggccc tgtgacgggc       180
     gaacgcttcc gcgcctacgt gaccgacacc ctggtcccca ccctgagacc cggcgacacc       240
     gtgatcctgg acaatctggg cgctcacaag gtggccggcg tgcgcgaggc gatcgcggca       300
     accggggccc ggctgcttta tcttcctccg tactcacctg agttcaaccc gattgagcag       360
     gccttcgcca agctgaaagc gctgttgcgc agggcggcgg cccgcagtgt cagtgaactc       420
     tgggcggcga tccaccaagc cttcaaatgc ttctcgccgg ctgagtgccg caactacttc       480
     acagctgctg gatacgagga tgatgcttac gcttcaacct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page