(data stored in ACNUC7421 zone)

EMBL: CP001349.PE571

CP001349.PE571       Location/Qualifiers
FT   CDS_pept        complement(649189..649572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0586"
FT                   /product="transposase"
FT                   /note="KEGG: mrd:Mrad2831_5182 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55623"
FT                   /db_xref="GOA:B8IC28"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC28"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5182"
FT                   /protein_id="ACL55623.1"
FT                   /translation="MPSALSVDLRQRVVSAVAEGASCHQAAARFGVSVASVSRWSRQQE
FT                   GQGDVTPKPMGGDQRSQRIEAHAELILQTYQAHPQSFLHELCETLQEQGVPVSRSSLSR
FT                   FFARHRITRKKGRRTQLSRSGRM"
     atgccctcag ctttgtctgt cgacctgcgc cagcgcgtcg tctcggccgt tgcagaaggc        60
     gcctcctgcc atcaggccgc cgcgcgcttc ggggtcagcg tggccagcgt cagccgctgg       120
     tccaggcagc aggagggcca gggagatgtc acgcccaagc ccatgggcgg cgaccagcgc       180
     tcgcagcgca tcgaggctca tgccgagctc atcctgcaga cctaccaagc ccacccgcag       240
     agcttcctgc atgagctctg cgagacgctc caggagcaag gcgttccggt cagccgcagt       300
     agcctgtcgc gcttcttcgc ccggcaccgc atcacgcgga aaaaagggcg acgtacgcag       360
     ctgagcagga gcgggaggat gtaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page