(data stored in ACNUC7421 zone)

EMBL: CP001349.PE572

CP001349.PE572       Location/Qualifiers
FT   CDS_pept        complement(649655..650446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0587"
FT                   /product="Baseplate J family protein"
FT                   /note="PFAM: Baseplate J family protein; KEGG:
FT                   met:M446_4135 baseplate J family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55624"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ2"
FT                   /inference="protein motif:PFAM:PF04865"
FT                   /protein_id="ACL55624.1"
FT                   /translation="MVPSKRFADIDLSRLPPLPAVPGFDTIYAARMADVAARLNKAGIP
FT                   YNVTNLKADTVAIIQGAGAYREELVYTAHDDASRAVLLATSWGPYLDHLGATQTPPVAR
FT                   LPLVDRPRPYVFGTDSVSDWEEDDDFRARIQLAPEELSGAGPEGAYLSFALGVAGIRAA
FT                   SCYGPMSFGGTPDNPFTPLGHVHVPIVGTDGDGTASDALVAAVQAALRPDDRRPIADFV
FT                   TASAATIIPYRIEAVLYVGGGADRAIVKAAAEKRFAAQARL"
     atggtcccct cgaagaggtt tgcggacatc gacctgtcgc gcctgccgcc gctgcccgcg        60
     gtgccgggct tcgacacgat ctatgcggcg cgcatggccg acgttgccgc gcggctcaac       120
     aaggccggca tcccttacaa cgtcaccaac ctcaaggccg acaccgttgc gatcatccag       180
     ggggccggcg cctaccgcga ggagctggtc tatacggctc atgacgatgc ctcccgggcc       240
     gtcctgctgg cgacgagctg gggcccgtac ctcgaccatc tcggcgcgac gcagaccccg       300
     cccgtggcgc gcctgccgct ggtcgaccgc ccgcgcccct acgtgttcgg gacggacagc       360
     gtcagcgatt gggaggagga cgatgatttc cgggcccgca tccagctcgc gcccgaggag       420
     ttgagcggcg ctggcccgga gggcgcctac ctgtcgttcg cgctcggcgt tgcggggatc       480
     agggccgcga gctgctacgg cccgatgagc tttgggggca cgccggacaa cccgttcacg       540
     ccgctcggcc atgtccacgt tccgatcgtc ggtaccgacg gcgacggcac cgcctcggac       600
     gccctggtcg ccgcggtcca ggccgcgttg cggccggatg atcgccggcc gatcgcggat       660
     ttcgtcactg cctcggcggc cacgatcatc ccctaccgga tcgaggcggt gctctacgtc       720
     ggcggcggcg cggaccgggc gatcgtcaaa gcggcggccg agaagcggtt tgcggcccag       780
     gccaggctct ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page