(data stored in ACNUC7421 zone)

EMBL: CP001349.PE573

CP001349.PE573       Location/Qualifiers
FT   CDS_pept        complement(650477..650899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0588"
FT                   /product="GPW/gp25 family protein"
FT                   /note="PFAM: GPW/gp25 family protein; KEGG: met:M446_4136
FT                   gpW/GP25 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55625"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ3"
FT                   /inference="protein motif:PFAM:PF04965"
FT                   /protein_id="ACL55625.1"
FT                   /translation="MASCGLDRDTGEPLFDLAHVAQAVQTIFTTRLGERVMLRWFGGGL
FT                   AELLGRRITPALLRSYRMLLALAIATWEPRLQVVKIDGTGNSTDAIALGHLKFTAICYY
FT                   RPRGHLGDYTVEGGPRALNIFSPDGKTLRVQLARVA"
     atggcctcct gcggcctgga tcgcgacacg ggcgagccgc tgttcgatct cgcccacgtc        60
     gcccaggccg ttcagacgat cttcacgacg cgcctgggcg agcgggtcat gctgcgctgg       120
     ttcggcggcg ggctcgccga actgctcggc cggcgcatca cgccggccct cctgcgcagc       180
     taccggatgc tgctcgcgct cgccattgcg acctgggagc cccgcctcca ggtcgtgaag       240
     atcgacggca ccggcaactc cacggacgct attgcgctgg gccatctcaa gttcacggcg       300
     atctgttact accgcccgcg cggccatctc ggagattata cagtcgaggg cggcccccgc       360
     gccctcaata tcttctctcc ggatggcaag acgctccgcg tccagcttgc gcgcgtcgct       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page