(data stored in ACNUC7421 zone)

EMBL: CP001349.PE574

CP001349.PE574       Location/Qualifiers
FT   CDS_pept        complement(650903..651268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55626"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55626.1"
FT                   /translation="MTKALYRVTEAAPPRVHGRRVAPGDLLSLSEAEARYERDLGHIVP
FT                   TTVEGEAQPLVGLTEAERAALPPLELLGDGPVEYAVGEGRWSEGTGVPLTGIDLPADGV
FT                   EREVTLASTAIPAEPDA"
     atgacgaaag ctctctaccg cgtcaccgag gcggcgcccc cgcgcgtgca cggccgccgg        60
     gtcgcccccg gcgacctgct gtctctgagc gaggctgagg cacgctacga gcgcgacctc       120
     gggcacattg tgccgacgac ggtcgaaggg gaggcgcagc cgctcgttgg cctcaccgag       180
     gccgagcggg cggcgctgcc gcctctggag ctgctcggcg acggaccagt cgaatatgcg       240
     gtcggcgagg ggcgctggag cgagggcaca ggagttccgc taacgggaat cgatctgccg       300
     gccgatgggg tggagcggga ggtcaccctc gccagcaccg caattccggc cgagcccgac       360
     gcctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page