(data stored in ACNUC7421 zone)

EMBL: CP001349.PE575

CP001349.PE575       Location/Qualifiers
FT   CDS_pept        complement(651285..651854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0590"
FT                   /product="phage baseplate assembly protein V"
FT                   /note="TIGRFAM: phage baseplate assembly protein V; KEGG:
FT                   met:M446_4138 phage baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55627"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ5"
FT                   /inference="protein motif:TFAM:TIGR01644"
FT                   /protein_id="ACL55627.1"
FT                   /translation="MSDFSDLLDAVLELRREHEALKTRVANLIRPGKVTDRDHEKGVRI
FT                   DLGGGTDEEPNKSTWVKSSDHSGVMSYLPREGEQGWLLSPNGDQEQGAFWPLTHSDQKR
FT                   DPAPDADTTVLFNRDDVTISIKDGTVHIKTKKKITWEVDGKSYTFDGKEHVFQGDKIKH
FT                   DGKNIGKDHVHGGVQTGNLKTDVPDA"
     gtgagcgact tctccgacct cctggacgcg gtcctggagc tgcgccgcga gcacgaggcc        60
     ctgaagaccc gcgtcgcgaa tctgatccgc cccggcaagg tcacagaccg cgaccacgag       120
     aagggcgtgc gcatcgacct cggcgggggc actgacgagg agccgaacaa gtcgacctgg       180
     gtcaagtcct ccgaccactc gggcgtgatg agctatctgc cccgcgaggg cgagcagggc       240
     tggctcctct ctcccaacgg cgaccaggag cagggcgcgt tctggccgct gacccattcc       300
     gatcagaagc gggatccggc acccgacgcg gacacgacgg tcctgttcaa ccgggatgat       360
     gtgacgatat cgatcaagga cggaactgtc cacatcaaga caaaaaagaa aatcacctgg       420
     gaagtcgatg gtaagtcgta caccttcgac ggtaaggaac acgtcttcca aggcgacaag       480
     atcaagcacg acggcaagaa catcggcaag gatcacgttc acgggggcgt ccagacgggc       540
     aacctcaaga cggacgtgcc ggacgcctaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page