(data stored in ACNUC7421 zone)

EMBL: CP001349.PE576

CP001349.PE576       Location/Qualifiers
FT   CDS_pept        complement(651851..652627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55628"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ6"
FT                   /inference="similar to AA sequence:KEGG:M446_4139"
FT                   /protein_id="ACL55628.1"
FT                   /translation="MSLTGFAIRTCLKRALRGATLAEDRVKDSLITPLDLLAADTPQPL
FT                   LIVSTDDDLRQAEVRTPRDRRRELDVVIEMALATAVAIDDGTVRLEMPHTDAGMEATLD
FT                   IMAWQVRAALKDPTNPWAELYRTFRGEVRKILTRRGASTEDGVRFAARQIIITVDPLQE
FT                   PERGRDAIPTPWDGLVAQMRADAELEPYGDLLATLLTGSTLPPWQAVQAQLGQTRAVMD
FT                   AVGLSALHGAEAEPPVSQVTITTDRGDIVETLEPVP"
     atgagcctca ccggctttgc catccgcacc tgcctcaagc gggcgctgcg gggtgccacg        60
     ctcgcagagg accgggtcaa ggacagcctg atcacgccgc tcgacctcct cgccgcggac       120
     acgccccagc cgctcctcat cgtctcgacc gacgacgatc tgcggcaggc cgaggtgcgc       180
     actccgcgcg accgcaggcg ggagctcgac gtcgtgatcg agatggcgct cgcgaccgcg       240
     gtcgccatcg acgatgggac ggtccgcctg gagatgcccc atacggatgc gggcatggag       300
     gccaccctcg acatcatggc ctggcaggtg cgggcggcgc tgaaggatcc gacgaatccc       360
     tgggcggagc tctaccggac cttccggggc gaggtgcgca agatcctcac ccgccgcggc       420
     gccagcaccg aggacggggt tcgcttcgcc gcgcgccaga tcatcatcac ggtcgatccg       480
     ctgcaggagc ccgagcgggg gcgtgacgcg atcccgacgc cctgggatgg gctcgtggcg       540
     cagatgcggg cggacgcgga gctggagccc tatggcgacc tcctcgcgac gctcctcacc       600
     ggctcgaccc tgccgccctg gcaggcggtg caggcgcagc ttgggcagac ccgcgccgtg       660
     atggacgcgg tcggcctgag tgccctgcac ggcgccgagg ccgagccgcc ggtctcgcag       720
     gtcacgatca ccacggatcg aggggacatc gtcgagaccc tggagccggt gccgtga          777
//

If you have problems or comments...

PBIL Back to PBIL home page