(data stored in ACNUC7421 zone)

EMBL: CP001349.PE577

CP001349.PE577       Location/Qualifiers
FT   CDS_pept        complement(652627..653037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_1502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55629"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ7"
FT                   /inference="similar to AA sequence:KEGG:Oant_1502"
FT                   /protein_id="ACL55629.1"
FT                   /translation="MPSPFALAMQKAHTVRTATFGEAIRITPMAGEGEMAARTPDPARP
FT                   EREVRGVFTLRPGEDTLQGVRRGTELNGMTRVAVAPAQVWFEASVLAGLGYALKPDDRI
FT                   TLTERPGQPVYTIVKRGPTDLDDATVPLVRAT"
     atgccatcgc ccttcgccct ggcgatgcag aaggcccaca ccgtgcgcac cgcgaccttc        60
     ggcgaggcca tccggatcac gccgatggcg ggcgagggcg agatggcagc tcgcacgccc       120
     gatcccgccc ggcccgagcg ggaggtgcgg ggcgtgttca ccctgcggcc gggcgaggac       180
     acgctgcagg gcgtccgccg cggcaccgaa ctcaacggga tgacgcgggt cgcggtcgcc       240
     ccagcgcagg tgtggttcga ggcgagcgtg ctggcgggcc tcggttacgc actcaagccc       300
     gacgaccgga tcacgctgac cgagcggcca ggccagcctg tctacacgat cgtcaagcgc       360
     ggcccgaccg atctcgacga cgccactgtc cccctcgtgc gagcgacctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page