(data stored in ACNUC7421 zone)

EMBL: CP001349.PE578

CP001349.PE578       Location/Qualifiers
FT   CDS_pept        complement(653424..654461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55630"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ8"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_1263"
FT                   /protein_id="ACL55630.1"
FT                   /translation="MPTILDVFQSPHFSARALTDGVNAVPNRYHRLEQLNVFPIRPVPT
FT                   TYVTIEYRNGILNLLPTRERGTAGSQGLRGRRDKRTFEIPHIPHDDALMATDLQNRITF
FT                   GTNDVLTPMMDAMTEKLADMTAKHFITLEHLRVGAIKGQILDADGSLIYDLFQEFGITA
FT                   KVFAFTFSDPNFDVGAKARELKGYLEDNLQGEVMTSVRALCSQEFFASFVGHPSVQKAY
FT                   QFYTSAQEPLRNDVRKGFEFKGISWEEYRGSATYLEADNSQTRTRFIDQGTAQFYPEGT
FT                   QQTFATYIAPPDSVDEANMAPKPGQLIYAKQERMKFDKGIEIHTESNPLPLCKRPALLV
FT                   KGTSN"
     atgccgacca tcctcgacgt cttccagagc ccgcactttt cggcgcgggc gctcacggat        60
     ggggtcaacg ccgtcccgaa ccgctatcac cgccttgagc agctcaacgt cttcccgatc       120
     cgtccggtcc cgaccaccta cgtcacgatc gagtaccgta acggcatcct caacctgctg       180
     ccgacgcgcg agcgcgggac tgcgggcagc cagggtctgc gcgggcgccg ggacaagcgc       240
     acgttcgaga tcccgcacat cccgcacgat gacgcgctga tggcgacgga tctccagaac       300
     cggatcacct tcggcaccaa cgacgtactg acgccgatga tggacgcgat gaccgagaag       360
     ctcgcggaca tgacggccaa gcacttcatc acgctggaac atctgcgggt cggcgcgatc       420
     aaggggcaga tccttgatgc cgatggctcg ctgatctacg acctctttca ggagttcggg       480
     atcaccgcga aggtgttcgc tttcaccttc tccgacccga acttcgatgt tggcgcaaag       540
     gctcgtgagc tcaagggtta tctggaggac aacctccagg gcgaagtgat gacgagcgtg       600
     cgcgcccttt gctcgcagga gttcttcgcg agcttcgtcg gccacccgag cgtccagaag       660
     gcctaccagt tctacacctc tgcccaggag ccgctgcgca acgacgtgcg caagggcttc       720
     gaattcaagg gcatctcctg ggaggagtac cgcggctcgg caacctatct cgaagccgac       780
     aactcgcaga cccgcacccg gttcatcgac cagggcacgg cgcagttcta cccggaaggg       840
     acgcaacaga ccttcgccac ctacatcgcg ccgccggact cggtcgacga ggccaacatg       900
     gcgccgaagc cgggccagct gatctacgcc aagcaagagc ggatgaaatt cgacaagggc       960
     atcgagatcc acaccgagtc gaacccgctg ccgctgtgca agcgcccggc tctgctcgtc      1020
     aagggcactt cgaactga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page