(data stored in ACNUC7421 zone)

EMBL: CP001349.PE579

CP001349.PE579       Location/Qualifiers
FT   CDS_pept        complement(654468..654857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_2770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55631"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ9"
FT                   /inference="similar to AA sequence:KEGG:mma_2770"
FT                   /protein_id="ACL55631.1"
FT                   /translation="MPPASYLAREPKRLSDVLRYHQPTYSLDQGTLAANAAALEFATPL
FT                   ALAADGSGQFVPWVPGANDSTGVVVGLSASQTQVKAATQPIAVIARHATVVRNAIEFPA
FT                   GATAAQISAALAALASHGIIARQGA"
     atgcctcccg cctcgtatct cgctcgtgag cccaagcggc tctccgacgt cctgcgctac        60
     caccagccga cctacagcct cgaccagggc acgctcgcgg ccaatgcggc ggccctggag       120
     tttgccacgc cactggcgct cgccgccgat ggctccggcc agttcgtgcc ctgggtgccc       180
     ggcgcgaacg actccacggg cgtggtggtc gggctctcgg ccagccagac gcaggtcaag       240
     gctgcaaccc agcccatcgc cgtcatcgcg cgccacgcca cggtggtgcg caacgccatc       300
     gagttcccgg ccggcgccac agcggcccag atctccgccg cactcgccgc gctcgcgagc       360
     cacggcatca tcgctcgcca gggggcctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page