(data stored in ACNUC7421 zone)

EMBL: CP001349.PE58

CP001349.PE58        Location/Qualifiers
FT   CDS_pept        65668..66780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0059"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: met:M446_0059 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55110"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU65"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL55110.1"
FT                   /translation="MIRTVLAALVLILGAGRAGAEEVTRFPAPEWQRVELTIRSAADVD
FT                   AMAPLIRDFQSLSPDVAVIYVEYETADLYAQAAAACAAGRAAGFSADLLISSSVDHLVE
FT                   LANDGCARSYRSAETARLPAYALWRDEVFGFTTEPAVIAYRPDLVPPDDVPHSRAALVD
FT                   LLREKAGRYAGRVGSYDITVSGIGYLFAAYDARSAVTYGRLVEAFGRANLQVRCCTGAL
FT                   IADLEAGRIALGYNLLGSYVYGAMRRGAKLGIVVPRDYTLVLSRAALIPTTAAHAAEGF
FT                   AFLDYLLSERGRRVSRDQAFFFDLTGPLPPGIDGPPSLAAAGVFRPIPLGPALLAVQDH
FT                   AKRARFLAEWRQSIGLDRPAAGPNGQARRP"
     gtgatccgga ccgtgctggc tgcgctggtg cttatcctcg gtgcgggccg tgcgggcgcc        60
     gaggaggtga cgcggttccc ggccccggaa tggcagcgcg tggagctgac gatccggtcc       120
     gccgccgatg tcgatgcgat ggccccgctg atccgggact tccagtccct ctcgcccgat       180
     gtcgcggtga tctatgtcga gtacgagacc gccgatctct acgcgcaggc cgccgccgcc       240
     tgtgcggccg ggcgcgccgc cggcttttcc gccgacctgt tgatctcctc gtccgtcgac       300
     cacctcgtcg aactcgccaa tgacggctgc gcccggtcct accgctccgc cgagaccgcc       360
     cggctgccgg cctatgccct gtggcgcgac gaggtgttcg gcttcaccac cgagccggcg       420
     gtgatcgcct accggccgga cctggtgccc ccggacgacg tgccccacag ccgcgccgcg       480
     ctggtggatc tgttgcgcga gaaggcggga cgctacgcgg gccgggtcgg ctcctacgac       540
     atcacggtct cggggatcgg ctacctgttc gcggcctatg acgcgcgcag cgccgtcacc       600
     tatgggcgcc tcgtcgaggc cttcgggcgc gcgaacctcc aggtgcgctg ctgcaccggc       660
     gcgctgatcg ccgatctcga agccggccgc atcgcgctcg gctacaatct cctcggctcc       720
     tacgtctacg gcgccatgcg gcggggggcg aagctcggca tcgtggtgcc gcgcgactac       780
     acgctggtgt tgagccgcgc cgcgctcatt ccgaccacgg cggcccatgc tgccgagggc       840
     ttcgccttcc tcgattatct gctgtccgag cgcgggcggc gcgtgagccg ggaccaggcc       900
     ttcttcttcg atctcacggg ccccctgccc ccgggcatcg acggccctcc gagcctggcg       960
     gctgccggcg tgttccggcc gattccgctc ggcccggcgc tcctcgccgt gcaggaccac      1020
     gcgaagcggg cacgcttcct cgccgagtgg cgccagtcga tcggcctcga tcggccggcg      1080
     gccgggccga acgggcaggc ccgccggccc tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page