(data stored in ACNUC7421 zone)

EMBL: CP001349.PE580

CP001349.PE580       Location/Qualifiers
FT   CDS_pept        complement(654887..656149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0595"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: rsq:Rsph17025_0104
FT                   peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55632"
FT                   /db_xref="GOA:B8IDR0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDR0"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACL55632.1"
FT                   /translation="MSNPLLARFAGEPALVAPHARDRFEACLAAVMAAEHGPEMVREGA
FT                   AAEDGFWPEPGSWRAAYRPYVVTGGVLQIPVKGVLLHDFSFAVGSLVTGYVYIRRAFER
FT                   GMADPEVRGIALICDSPGGEVAGNFDLVDVLYAARGAKPVRAFAHEGAYSAAYSIASAA
FT                   DRIIVSRTGGVGSIGVVTAHIDASGALAQAGLKVTFIFAGEHKVDGNSAEPLPPEVKDR
FT                   IQARIDGLYDIFVAAVARNRSLKETAVRATKALTYAADEAIRTGLADAVGALDDAVAAF
FT                   AAELTPTAEDPSMITPEAHEAAVAAARADGEAAGRTAGEAVGATAAKVRIKAILGSDEA
FT                   KGRQDLAEHLAFDTDMAAEAAVAVLAKAPKMAPAAAEGADFLAAMRAQPNPDLGTGRSH
FT                   GADQGPSLADRMRARFDLPAA"
     atgtcgaacc ctcttctcgc acgcttcgcg ggcgagcccg ccctcgtcgc accgcatgcg        60
     cgcgaccgct tcgaagcctg cctcgccgcc gtcatggccg ccgagcacgg cccggagatg       120
     gtgcgagagg gggcggcggc cgaggatggg ttctggccgg agcccgggtc gtggcgggcg       180
     gcctatcggc cctacgtggt gaccggcggc gtgctgcaga ttcccgtcaa gggcgtgctg       240
     ctgcacgact tctcctttgc ggtcggctcg ctcgtcacgg gctacgtcta catccggcgc       300
     gccttcgagc gcggcatggc cgacccggag gtccggggca ttgctctgat ctgcgacagt       360
     cccggcgggg aggtggcagg caacttcgac ctcgtggacg tgctgtatgc cgcccgtggg       420
     gcgaagccgg tgcgcgcctt cgcccacgaa ggtgcatact cggcagccta ctccatcgcg       480
     agcgcggcgg accggattat cgtctcgcgc accggcgggg tcgggtcgat cggcgtcgtc       540
     acggcccata tcgatgcgtc gggcgcgctc gcccaggccg ggctcaaggt caccttcatt       600
     ttcgcaggtg agcacaaggt cgacggcaac tcggccgagc cgctcccgcc cgaggtcaag       660
     gatcggatcc aggcccggat cgacggactc tacgacatct tcgtggcggc ggtcgcccgc       720
     aaccgcagcc tgaaggagac ggcggtccgc gccacgaagg cgctgaccta cgcggccgac       780
     gaagccatcc gcactgggct cgccgatgcc gtcggcgcgc tcgacgacgc cgtggccgcc       840
     ttcgcggccg aactcacccc caccgcagag gaccccagca tgatcactcc ggaggcccac       900
     gaggccgccg tcgccgccgc gcgcgccgac ggggaagcgg ccggccgcac ggctggcgag       960
     gcggtcggtg ccaccgccgc caaagtccgc atcaaggcca tcctcggctc cgacgaggcc      1020
     aagggccgcc aggatctcgc ggaacacctc gccttcgaca ccgacatggc ggccgaggcc      1080
     gcggtggcgg tgctggcaaa ggcgccgaag atggcaccgg cagcggcgga gggcgccgat      1140
     ttcctggccg ccatgcgtgc ccagcccaat cccgacctcg ggacgggccg ctcccatggc      1200
     gccgaccagg ggccgagcct cgcggaccgc atgcgcgccc gcttcgacct gcccgccgcc      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page