(data stored in ACNUC7421 zone)

EMBL: CP001349.PE581

CP001349.PE581       Location/Qualifiers
FT   CDS_pept        complement(656179..657777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0596"
FT                   /product="phage portal protein, lambda family"
FT                   /note="TIGRFAM: phage portal protein, lambda family; PFAM:
FT                   portal protein lambda; KEGG: smd:Smed_1658 phage portal
FT                   protein, lambda family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55633"
FT                   /db_xref="GOA:B8IDR1"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDR1"
FT                   /inference="protein motif:TFAM:TIGR01539"
FT                   /protein_id="ACL55633.1"
FT                   /translation="MPGLPQILGPDGTPAQRVVASDTAYEGASRRHTDLARFAPFNFSA
FT                   QSAISYDRDLLSARIHDMARNDGWASGGVSRLVDAIIGSGWRLSSTPNARTLGLESDEA
FT                   ATLGETFEAYWQDYATDPDCWCDAGRRFTVGGLLALAFRHFVWDGEALGTLLWLERGGP
FT                   TATALRLIDPDRLSSPPSRMDSETLQDGVELGAYGEPIAYHIRTRHPGDLKATTSVLAW
FT                   ERIERETPWGRRKVLHHFEPERADQYRGVSKFAQIVKKLRMLGRYDEAEVQAAVLNALL
FT                   AAFVESPFDHQALADAMNGGGDDLDKYNAARLNYWDAAPVQLPGVKLNFLFPGEKVTFS
FT                   QAQRPNPGFEMFERVALRNIATALGTTYEQLSSDWSQVNYSSARAALIEVWRGFTARQG
FT                   FFGSGFLFPWYAAVLEEGIETGRLRLPSKLKSKPFRHFKAAYCAGRWIGPGRGWVDPLK
FT                   EAQAASLRIANSFSTLERECADQGTDWQEVLQQRARERKYAAELGLPDVHAPEVKAADS
FT                   GEGDQRPRKTADARD"
     atgccaggac tgccgcagat cctcggcccg gacggcacgc cggcccagcg ggtcgtcgcc        60
     tccgacaccg cctatgaggg ggcctctcgc cgccacacgg acctcgcccg cttcgcgccc       120
     ttcaacttct cggcccagag cgcgatctcc tacgaccgcg atctgctgtc ggcgcgcatc       180
     cacgacatgg cgcgcaacga tggctgggcc tcgggagggg tgtcgcgcct cgtcgatgcc       240
     atcatcggct cgggctggcg tctttcgtcg accccaaacg cgcgcacgct tggccttgag       300
     tcggacgaag ccgcaacgct cggcgagacc ttcgaggcgt actggcaaga ctacgccacc       360
     gatccggact gctggtgcga tgcggggcgt cgcttcacgg tcggcggact gctcgccctc       420
     gcgttccgcc acttcgtctg ggacggcgaa gcgctcggca ccctgctctg gctggagcgc       480
     ggcggtccga ccgcgacggc actgcgcctg atcgaccccg accgcctgtc ctcgccgccg       540
     agccgcatgg acagcgagac gctgcaggac ggggtcgagc tcggcgccta cggcgagccg       600
     atcgcctacc acatccgcac ccgtcacccg ggcgacctca aggcgacgac ctcggtgctc       660
     gcctgggagc ggatcgagcg cgagaccccg tgggggcgcc gcaaggtgct gcatcacttc       720
     gagccagagc gggccgatca gtaccggggc gtctcgaagt tcgcgcagat cgtgaagaag       780
     ctgcgcatgc tcggacgcta cgacgaggcc gaggtgcagg ccgcagtgct caatgcgctg       840
     ctcgcggcct tcgtcgagag cccgtttgac caccaggcgc tcgctgatgc catgaacggc       900
     gggggcgacg atctcgacaa gtacaacgcg gcgcgtctga actactggga tgcagccccg       960
     gtccagctgc cgggggtgaa gctcaacttc ctgtttccag gcgagaaggt cacgttctct      1020
     caggcccagc ggccgaatcc gggcttcgag atgttcgagc gggtggccct gcgcaacatc      1080
     gcgaccgcgc tggggacgac ctatgagcag ctgagttccg actggagcca ggtgaactat      1140
     tcgagcgccc gggccgcgct gatcgaggta tggcggggct tcacggcacg ccaaggcttc      1200
     ttcggcagcg gtttcctctt tccctggtac gccgcagtgc tggaggaggg gatcgaaacc      1260
     gggcgtctgc ggctgccgtc caagctcaag agcaagccgt tccgccactt caaggccgcc      1320
     tattgcgccg ggcgctggat cggccccggt cgcggctggg tcgatccgct gaaggaggcg      1380
     caggccgcga gccttcgcat tgccaacagc ttctcgacgc tcgagcgcga atgcgccgac      1440
     cagggcaccg actggcagga ggtgcttcag cagcgggcgc gcgagcgcaa atatgccgcg      1500
     gagctcggcc tgcccgacgt gcatgcgccg gaagtcaagg ccgccgactc cggtgagggc      1560
     gatcaacgcc cgcgaaagac cgccgacgcc cgagactga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page