(data stored in ACNUC7421 zone)

EMBL: CP001349.PE582

CP001349.PE582       Location/Qualifiers
FT   CDS_pept        complement(657777..658004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0597"
FT                   /product="Head-to-tail joining protein W gpW family
FT                   protein"
FT                   /note="PFAM: Head-to-tail joining protein W gpW family
FT                   protein; KEGG: ecd:ECDH10B_1348 head-to-tail joining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55634"
FT                   /db_xref="GOA:B8IDR2"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="InterPro:IPR036626"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDR2"
FT                   /inference="protein motif:PFAM:PF02831"
FT                   /protein_id="ACL55634.1"
FT                   /translation="MVTQAMLDEARAAYHQIVTGQGVQEARQDGNGTVRWHAASLAELR
FT                   RYINQLETALGLPATDWSGGTRTPARRVLF"
     atggtcacgc aggcgatgct cgacgaagcc cgcgcggcct atcaccagat cgtcaccggc        60
     cagggcgtgc aggaggcgcg gcaggacggg aatggcaccg tgcgctggca cgccgccagc       120
     ctcgcggagc tgcgccgcta catcaaccag ctggagaccg cgctcggtct gccggcgacg       180
     gactggagcg gcgggacgcg cacgcccgcc cgccgggtgc tgttctga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page