(data stored in ACNUC7421 zone)

EMBL: CP001349.PE59

CP001349.PE59        Location/Qualifiers
FT   CDS_pept        67135..67992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55111"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU66"
FT                   /inference="similar to AA sequence:KEGG:M446_2473"
FT                   /protein_id="ACL55111.1"
FT                   /translation="MSRPSPEHRPPPDADERRAVRPVVCYPVDALAPPDLDSYRAARLG
FT                   WERVAAVTVPPRDARSFTVPAGCFFRIVSVEGPQVGDLNLWSADDLGERFFSGKTRALH
FT                   GTHVTTGHRLWSSLPFLRPLATITDDTLDWYGFDEDGGGVHDVIGTRCDPYTHRLLTGG
FT                   TYHHCCHSNLTRALAAQTGLPPAQAKRHVHDVLNVFMCTGFTRDTHQYFMKASPVRPGD
FT                   YLEFFAEVDLLGALSACPGGDCSAEHSSDVARCYPLLIEVYRPKAPPAGWVSPARNSYA
FT                   APDA"
     ttgagccgcc cctctcccga gcatcgcccg ccgccggatg ccgacgaaag gcgcgcggtg        60
     cggccggtcg tctgctaccc ggtcgacgcg ctcgcgccgc cggatctcga cagctaccgg       120
     gccgcccgcc tcggctggga gcgtgtcgcg gccgtgaccg tgccgccgcg cgatgcacgc       180
     agcttcacgg tgccggccgg ctgcttcttc cggatcgtca gcgtggaggg accccaggtc       240
     ggtgacctga acctctggtc ggcggacgac ctcggcgaac gcttcttctc gggcaagacc       300
     cgggcgctgc acggcaccca tgtcaccacg ggccatcgtc tgtggtcgag cctgcccttt       360
     ctgcgcccgc tcgcgacgat cacggacgac acgctcgact ggtacggctt cgatgaagac       420
     ggcggcggcg tgcacgacgt gatcggcacc cgctgcgatc cctacaccca tcgcctgctc       480
     acgggcggaa cctaccacca ttgctgccac tcgaacctga cgcgggcgct cgcggcacag       540
     accgggctgc cgccagcgca ggccaagcgg cacgtgcacg acgtgctcaa cgtcttcatg       600
     tgcacgggct tcacccgcga tacgcatcag tacttcatga aggcgagccc ggtgaggccg       660
     ggtgactatc tggagttctt cgccgaggtc gatctcctcg gcgcgctgtc ggcctgcccc       720
     ggcggggatt gcagtgcgga gcattccagc gatgtcgccc ggtgctatcc gctgctcatc       780
     gaggtctacc ggcccaaggc gccgccggcc ggatgggttt cgccggcccg caacagctac       840
     gcggccccgg acgcgtga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page