(data stored in ACNUC7421 zone)

EMBL: CP001349.PE6

CP001349.PE6         Location/Qualifiers
FT   CDS_pept        8901..10046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0007"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: rpb:RPB_4238 PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55058"
FT                   /db_xref="GOA:B8ISZ6"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ6"
FT                   /inference="protein motif:PFAM:PF03929"
FT                   /protein_id="ACL55058.1"
FT                   /translation="MARLHPLLFQIHWFLGLSAGLVLMLCGVTGALLTFEDEIVEALSP
FT                   GIVTVAPRSAPRLTPDALLARLQAEAPGQRVALLTLSGEPERAARIRFAPEGGRGRGET
FT                   VYVDPYDGRILGPGRGEAAFGTILRLHRWLLIPGDGNGFGRTLTGASLLALVYLALSGL
FT                   YLRWPKRVGDWRVWLRPALSRRGRPLYWSLHAVVGTWVLAIYLVIALTGLWWSFGWYRD
FT                   GAALLLTGRLPRGEAAEARRDGPGSGGSLDRAFAAFETATDGRYAVATLAPPRGPEPIR
FT                   IRSVAPDAPHRQARDEWRIRPDGTVVSSDLYAARPLGEKLAGSMLALHEGRFFGWPGTL
FT                   LFFLAALAMPLFGVTGLLLYLGRRRSRRRAAARAEPVPQRG"
     atggcccgcc tgcatccgct cctgttccag atccactggt tcctcggcct cagtgccggc        60
     ctcgtcctga tgctgtgcgg cgtcaccggt gcgctcctga ccttcgagga cgaaatcgtc       120
     gaggcgctca gccccggcat cgtcacggtg gcgccgcgat ccgccccccg actcacgccg       180
     gacgcgctcc tcgcccggct ccaggcggag gcgccgggcc agcgggtcgc gctgctcacg       240
     ctctcgggcg agccggagcg ggccgcccgc atccgcttcg cgcccgaggg cgggcgggga       300
     cgcggcgaga cggtctatgt cgatccgtat gacggccgca tcctcgggcc gggccggggc       360
     gaggcggcct tcggcaccat cctgcgcctg caccgctggc tcctcatccc cggggatggc       420
     aacggcttcg gccgcaccct caccggcgcg agcctgctgg cgctggtcta tctcgcgctc       480
     tcggggctct atctgcgctg gcccaagcgg gtcggcgact ggcgggtctg gctgaggccg       540
     gcgctgagcc gccgcggccg gcccctctac tggtccctcc acgcggtcgt ggggacctgg       600
     gtgctcgcga tctacctcgt catcgccctc accggcctgt ggtggtcctt cggctggtat       660
     cgggacggcg ccgccctgct cctcaccggg cgtctgccgc gcggcgaggc cgcggaggcc       720
     cgccgggacg gccccggctc cggcggctcc ctcgaccggg ccttcgcggc cttcgagacc       780
     gccacggatg ggcgctatgc ggtcgcgacc ctggcgccgc cgcgcggccc cgagccgatc       840
     cgcatccgct ccgtggcccc ggacgccccc caccgccagg cccgcgacga gtggcgcatc       900
     cggccggacg gcaccgtcgt gtcgagcgat ctctacgccg cccgaccgct cggggagaag       960
     ctcgccggca gcatgctggc gctgcacgag gggcgcttct tcggctggcc cggcacgctc      1020
     ctgttcttcc tggccgcgct ggcgatgccg ctcttcgggg tcacgggcct gctcctctat      1080
     ctcgggcggc gccggagccg gcgccgggcc gccgcaaggg cggagccggt gccgcagcgg      1140
     ggatag                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page