(data stored in ACNUC7421 zone)

EMBL: CP001349.PE60

CP001349.PE60        Location/Qualifiers
FT   CDS_pept        complement(68147..68353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55112"
FT                   /db_xref="InterPro:IPR022037"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU67"
FT                   /inference="similar to AA sequence:KEGG:M446_3871"
FT                   /protein_id="ACL55112.1"
FT                   /translation="MADATHGRSTGDPERVLLDDADTRAFWARRLQVPIEQIEAAVEAV
FT                   GDDPARVAAHLGKPWPYEESGIV"
     atggcagacg ctacccacgg ccgatccacg ggcgatccgg aacgggtgct tctggatgat        60
     gccgacacac gcgccttctg ggcgcggcgc ctgcaggttc ccatcgagca gatcgaggcg       120
     gcggtcgagg cggtcgggga cgatcccgcg cgggtggccg cccatctcgg caagccgtgg       180
     ccctacgagg agagcggcat cgtctga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page