(data stored in ACNUC7421 zone)

EMBL: CP001349.PE61

CP001349.PE61        Location/Qualifiers
FT   CDS_pept        complement(68448..69587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0063"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   met:M446_3465 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55113"
FT                   /db_xref="GOA:B8IU68"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU68"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACL55113.1"
FT                   /translation="MGLITYLTRIQFERGAIRLIDEELALLGARRPLIVTDRGVVAAGL
FT                   IARIAAASRLVADAPVFDATPENPTEAAVLAARDLFREHGCDAVVAVGGGSPLDLAKGA
FT                   ALLATHAEPLAQYAAILGGLPRIRADQPPVLAVPTTAGTGSEVGRAALITLSDGRKLGF
FT                   ISPHLIPNVAICDPELTIGLPPGLTAATGMDAVTHCIETYLSPRYNPPAEAIALDGLRR
FT                   ATRALRRAVRDGGDLEAREDMMMAALEGGMTFQKGLGAVHSMSHALGGRQAKPLHHGTL
FT                   NAVILPHVLRFNEPACTDKYAALREAMNLPPGADLPAAIEALNRDLGLPATLAELGVTA
FT                   QDCEGLIPWAVEDHSTATNGRPLGADDFRHLFIAALGSS"
     atgggtctca tcacctatct cacgcgcatc cagttcgagc ggggcgcgat tcgcctcatc        60
     gacgaggaac tcgccctgct cggcgcacgg cgaccgctga tcgtcacgga tcgcggcgtc       120
     gtcgcggccg ggctcatcgc gcgcatcgct gcggcgagcc gtctcgtcgc cgacgcgccg       180
     gtcttcgacg ccacgcccga gaacccgacc gaagccgccg tactggcggc gcgcgacctc       240
     ttccgcgagc atggctgcga tgcggtggtc gccgtcggcg gcggctcgcc gctggacctc       300
     gccaagggcg cggcgctgct cgccacccat gccgagccgc tcgcgcagta tgcggccatc       360
     ctcggcggcc tgccgcgcat ccgcgccgac cagcccccgg tcctggcggt gccgacgact       420
     gcggggaccg gcagcgaggt cgggcgggcg gccctgatca ccctctcgga cggccgcaag       480
     ctcggcttca tctcgccgca cctgatcccg aatgtggcga tctgcgaccc cgagctgacg       540
     atcggcctcc cgcccggcct caccgccgcc accgggatgg atgcggtcac ccattgcatc       600
     gagacctatc tgagcccgcg ctacaacccg cccgcggagg caatcgccct cgacgggctg       660
     cggcgcgcca cgcgcgcgct ccggcgggcg gtccgggacg gcggcgacct cgaggcccgc       720
     gaggacatga tgatggccgc cctcgagggc ggtatgacct tccagaaggg gctcggcgcc       780
     gtccactcga tgtcgcacgc gctgggcggg cgtcaggcga agccgctgca tcacggcacg       840
     ctcaatgccg tgatcctgcc gcacgtcctg cgcttcaacg agccggcctg cacggacaag       900
     tacgcggcgc tgcgggaggc gatgaacctg ccccccggtg ccgacctccc ggccgccatc       960
     gaggcgctca accgcgacct cggcctgccg gcgaccctcg ccgaactggg cgtgaccgct      1020
     caggattgcg agggcctgat tccgtgggcg gtggaggacc attccacggc caccaacgga      1080
     cgcccgctcg gcgccgacga cttccggcat ctgttcatcg cggccctcgg ctcttcgtga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page