(data stored in ACNUC7421 zone)

EMBL: CP001349.PE62

CP001349.PE62        Location/Qualifiers
FT   CDS_pept        69889..71154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0064"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   met:M446_4762 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55114"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU69"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL55114.1"
FT                   /translation="MRKLAPAATRRLVRVLLASTILVGSHAVTSSVQAADPIRIAVIAE
FT                   AQALAGASIPQAAQLAADEINAKGGIDGRMVELVTYDNKSSAADSVRAFQRAASEDKVH
FT                   AVIASYISEVVLALQPWSARLKMPFITPGAASNEIPLNVHKDYARNKYSFHGYLTSKAQ
FT                   SQAVCDAAKAILVEGRQMKTAVIMSEDAAWTKPLDEGYKECLPKVGLQVLDHIRFSPST
FT                   TDFSPIFSRIEGAKPDVIVTGISHVGVQPTVQWRSQQLPIPMIGIASQATNATFWKETN
FT                   GATEGVLFEMFAAPGTNVTPKTAPFAEAFKAKYGNYPSYAGYTAYDEVYYIADAVRRAG
FT                   STDPDKLVEALEKTDWEGTLGRIQFYGRDDDFTHSIKYGPGLVSGMMMQWQDGKQLAVW
FT                   PPNVANGKLTFPSFVKAGTPAN"
     atgaggaaac tcgcgccggc cgcgacgcgg cggctcgtcc gtgtgcttct cgcctcgacc        60
     atcctggtcg gcagccatgc cgtcacgtca tcggtccagg ccgcggaccc gattcgcatc       120
     gcggtgatcg ccgaggccca ggcgctcgcc ggcgcctcga tcccgcaggc ggcgcagctc       180
     gccgccgacg agatcaacgc gaagggcggc atcgacgggc gcatggtcga gctcgtcacc       240
     tacgacaaca agagctccgc ggcggattcc gtccgcgcct tccagcgcgc cgcgagcgag       300
     gacaaggtcc acgccgtcat cgcgagctac atcagcgagg tggtgctcgc cctgcagccg       360
     tggtcggcgc gcctgaagat gcccttcatc acgccgggcg cggcctcgaa cgagatcccg       420
     ctcaatgtcc acaaggacta cgcccgcaac aagtattcct tccacggcta tctgacctcc       480
     aaggcgcagt cgcaggcagt ctgcgacgcc gccaaggcga tcctcgtcga gggccgccag       540
     atgaagaccg ccgtgatcat gagcgaggac gcggcttgga cgaagcccct ggacgagggc       600
     tacaaggaat gcctgccgaa ggtcggcctg caggttctcg atcacatccg gttctcgccg       660
     agcaccaccg atttcagccc gatcttcagc cgcatcgagg gcgccaagcc cgacgtgatc       720
     gtcaccggca tctcgcatgt gggcgtccag ccgaccgtgc agtggcgcag ccagcaactg       780
     ccgatcccga tgatcggcat cgcctcgcag gcgacgaacg ccaccttctg gaaggagacg       840
     aacggcgcca ccgagggcgt gctgttcgag atgttcgccg cgccgggcac caatgtcacc       900
     ccgaagaccg cccccttcgc ggaggcgttc aaggcgaagt acggcaatta tccgagctac       960
     gccggctaca ccgcctatga cgaggtctac tacatcgccg atgcggtgcg gcgggcggga      1020
     tcgaccgacc cggacaagct ggtcgaggcg ctggaaaaga ccgactggga gggcacgctc      1080
     gggcggatcc agttctatgg ccgcgacgac gacttcaccc actcgatcaa gtacgggccg      1140
     ggcctcgtct ccggcatgat gatgcaatgg caggacggca agcagctcgc cgtctggccg      1200
     ccgaacgtgg cgaacggcaa gctcactttc ccgagcttcg tgaaggccgg cacgcccgcg      1260
     aactga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page