(data stored in ACNUC7421 zone)

EMBL: CP001349.PE63

CP001349.PE63        Location/Qualifiers
FT   CDS_pept        71240..72115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0065"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_4763 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55115"
FT                   /db_xref="GOA:B8IU70"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU70"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55115.1"
FT                   /translation="MTAIQILIDGFAISALYALGATGFTLIFGVSGVLNLSHGALMVTA
FT                   AVVAWAASSELGLGSYAGAAVGVAVCTLLTLATYGIVVKPIDRSKAIPAEEKEIFILTG
FT                   TLLWGIMIQEFIAYLFTSNAKTVMPIVEGVVTIAGVRTPWNQIFTAVVCWGTIALLWLL
FT                   VNRTRTGKVVLAASMNPRGVTLLGFELSKIYVAIWLIYGVLAGIAGVLLGQFLGVSSYS
FT                   VGPLTASAFSIVVLGGLGSVSGSLIAAYVVGYLETITAYLISPAYRTIPALLLLVAVMY
FT                   VRPQGLLGRR"
     atgaccgcca tccagatcct catcgacggc tttgccatct cggcgctcta tgcgctcggc        60
     gccaccggct tcaccctgat cttcggcgtg tccggcgtgc tcaacctctc ccacggcgcg       120
     ctgatggtga cggcggcggt cgtcgcctgg gccgcatcga gcgaactcgg cctcggctcc       180
     tatgcggggg cggcggtcgg ggtcgcggtc tgcacgctgc tcacgctcgc cacctacggc       240
     atcgtcgtga agccgatcga ccgctcgaag gcgatccccg ccgaggagaa ggagatcttc       300
     atcctcaccg gcacgctcct gtgggggatc atgatccagg agttcatcgc ctacctgttc       360
     accagcaatg ccaagaccgt gatgcccatc gtcgagggcg tggtcacgat cgcgggcgtg       420
     cgcaccccct ggaaccagat cttcacggcg gtggtgtgct ggggaaccat cgcgttgctc       480
     tggctgctcg tgaaccgcac ccgcaccggc aaggtggtgc tcgccgcctc gatgaacccg       540
     cgcggcgtca ccctgctcgg cttcgaactg tcgaagatct atgtggcgat ctggctgatc       600
     tacggggtgc tggccggcat cgcgggcgtg ctgctcggcc agttcctcgg cgtctcgtcc       660
     tacagcgtcg ggccgctcac cgcgagcgcc ttctcgatcg tggtgctcgg cgggctcggc       720
     agcgtctccg gttcgctcat cgccgcctac gtggtcggct acctggagac cataaccgcc       780
     tacctgatct ccccggccta ccgcaccatc ccggcgctgc tgcttctggt ggcggtgatg       840
     tatgtgcgcc cgcaaggcct gctcggacgc cgctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page