(data stored in ACNUC7421 zone)

EMBL: CP001349.PE64

CP001349.PE64        Location/Qualifiers
FT   CDS_pept        72137..73063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0066"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_4764 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55116"
FT                   /db_xref="GOA:B8IU71"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU71"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55116.1"
FT                   /translation="MVQKLLNSPLFWLSLVGLALASVLPLWVSGYVLGLLTIAYYFGVF
FT                   SMAWDLLFGFAGEVNFGPTFLIGLGAYSAGILNGHGVSIPLCLAAGAVAAVIGGLVLAL
FT                   PALRVRGPYFGLTTVVAVLILQNFIVVFAETTGGEIGLTVPDVISVDAATNYWIALGFM
FT                   TVSGLILFAIAASPVGLILQASGQDPVEAGALGFNVAKHKLAAFCVSAFFSGLAGALLV
FT                   FYMGTASVGTLVDVSVGVQVIIGAVLGGRRTILGGVLGAVFLIAAGELLRPLGSLSTFV
FT                   VSAAALAVILFVPAGLLGILTRQGQRA"
     atggtgcaga aactcctcaa cagcccgctc ttctggctca gcctggtcgg gctcgccctc        60
     gcctcggtgc ttccgctctg ggtctcgggc tacgtcctcg gcctgctcac catcgcctat       120
     tacttcggcg tgttctcgat ggcctgggac cttctgttcg gctttgccgg ggaggtgaat       180
     ttcgggccga ccttcctgat cgggctcggc gcctactcgg ccgggatcct caatggccat       240
     ggcgtctcga tcccgctctg cctcgcggcc ggcgccgtcg cggcggtgat cggcggcctc       300
     gtgctcgcgc tcccggcctt gcgcgtgcgc ggaccctatt tcgggctcac gacggtcgtg       360
     gcggtgctga tcctgcagaa cttcatcgtg gtcttcgccg agaccacggg cggcgagatc       420
     ggcctcacgg tgccggacgt catcagcgtc gacgccgcca cgaattactg gatcgccctc       480
     ggcttcatga ccgtgagcgg gctgatcctg ttcgcgatcg ccgcctcgcc ggtcgggctg       540
     atcctccagg cgagcggaca ggatccggtc gaggccggtg cgctcggctt caacgtcgcc       600
     aagcacaagc tcgcggcctt ctgcgtcagc gccttcttct ccggtctcgc cggtgcgctc       660
     ctcgtcttct acatggggac ggcctcggtc gggacgctcg tcgacgtctc ggtcggcgtt       720
     caggtcatca tcggcgcggt gctgggcggc cggcgcacca tcctgggcgg ggtgctcggt       780
     gcggtcttcc tgatcgcggc gggcgagctc ttgcggccgc tcggctcgct ctcgaccttc       840
     gtggtctcgg cggcggccct cgccgtgatc ctgttcgttc ccgcgggtct cctcgggatc       900
     ctgacccgcc aggggcagcg ggcgtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page