(data stored in ACNUC7421 zone)

EMBL: CP001349.PE65

CP001349.PE65        Location/Qualifiers
FT   CDS_pept        73089..74597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0067"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_4765 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55117"
FT                   /db_xref="GOA:B8IU72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU72"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55117.1"
FT                   /translation="MTAAVLPIPPRPAPMAGRPLLAVEGLQKRYGGLVAVKSIGFTVAP
FT                   GEILGLIGPNGSGKSTVMKLIMGLERPNAGSVKLDGVEIAGWPSHRVARAGIGLVFQHS
FT                   RPLHRQTVLENIKLALLPDNLLRLFADPHVEERARAIAERVGLGAVMDRRPATLPFADL
FT                   RRMELAKAIARDPKVVLVDEPFAGLTQAEVADFSQLIRGFRDEGKAVLLVDHNVKSVAA
FT                   LVDRVFAMYLGERVAEGSATEVMRNETVRRVYLGGSIETAARPESSFSGESLLGIDNLN
FT                   VLYGKAQALQGVSLHVHEGEFVSVVGLNGAGKTTLFNAVSGLVPYTGTITYGGETLARR
FT                   SPASIARSGIVQVPESRELFGEMSVRENLDLGGQHLPKAEAARQLDWLLDLFPILRSRS
FT                   GQMARTLSGGEQQMLTIARALMMRPRLLILDEPTLGLAPVILEQLSKAMERLRQTTPIT
FT                   VLLGEQNVTFALPHADRVYVLEHARIVWEGTPDRFAAEAGTGYL"
     atgacagctg ccgtcctgcc gatccccccg cggcccgcac cgatggcggg ccgccccctt        60
     ctcgccgtgg agggcctgca gaagcgctac ggcgggctcg tcgcggtcaa gtcgatcggc       120
     ttcacggtcg cgcccggcga gatcctgggc ctgatcgggc cgaacggctc gggcaagtcg       180
     accgtgatga agctcatcat ggggctcgag cggccgaatg ccggcagcgt gaagctcgac       240
     ggggtcgaga tcgccggctg gccctcgcac cgggtcgcgc gggccgggat cggcctcgtc       300
     ttccagcatt cccggccgct gcatcgccag accgtgctgg agaacatcaa gctcgcgctc       360
     ctgcccgaca acctgctgcg gctcttcgcc gatccgcacg tcgaggaacg ggcgcgcgcc       420
     atcgcggagc gcgtgggcct cggcgccgtg atggaccggc ggcccgcgac cctgcccttc       480
     gcggatctgc gccggatgga gctcgccaag gcgatcgccc gcgaccccaa ggtggtgctg       540
     gtcgacgagc ccttcgcggg tctgacgcaa gccgaggtcg ccgatttctc gcaactgatc       600
     cggggcttcc gggacgaggg caaggccgtg ctcctcgtcg accacaacgt gaagagcgtc       660
     gcggcgctcg tcgaccgggt cttcgccatg tatctcggcg agcgggtagc cgagggctcc       720
     gccacggagg tgatgcgcaa cgaaaccgtg cggcgcgtct atctcggcgg cagcatcgag       780
     accgccgcgc gcccggaatc ctccttctcg ggcgagtcgc tcctgggaat cgacaatctg       840
     aacgtgctct acggcaaggc ccaggcgctg cagggggtga gcctgcatgt gcacgagggc       900
     gagttcgtct ccgtggtggg actgaacggg gcgggcaaga cgacgctctt caacgccgtc       960
     tcggggctcg tgccctacac gggcacgatc acctatggcg gcgaaaccct cgcgcgccgc      1020
     agcccggcct cgatcgcccg gtccggcatc gtgcaggtgc ccgagagccg cgagctgttc      1080
     ggagagatga gcgtgcgcga gaatctcgat ctcggcggcc agcacctgcc gaaggccgag      1140
     gccgcccgcc agctcgactg gctgctcgac ctcttcccga tcctgcgcag ccgcagcggc      1200
     cagatggccc gcacgctctc gggcggggag cagcagatgc tgacgatcgc ccgcgcgctg      1260
     atgatgcgcc cgcgcctcct catcctcgac gagccgacgc tcgggctcgc accggtcatc      1320
     ctcgaacagc tctcgaaggc gatggagcgg ctgcgccaga ccacgccgat caccgtgctg      1380
     ctcggcgagc agaacgtcac cttcgccctg ccccacgccg accgcgtcta cgtgctggag      1440
     catgcccgca tcgtctggga gggcacgccc gaccgcttcg ccgctgaagc cggcaccggc      1500
     tatctctga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page