(data stored in ACNUC7421 zone)

EMBL: CP001349.PE66

CP001349.PE66        Location/Qualifiers
FT   CDS_pept        complement(75039..75563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0068"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_5564 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55118"
FT                   /db_xref="GOA:B8IU73"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU73"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL55118.1"
FT                   /translation="MDEEAGTVTPGPGAETIELVAGIVSAYVSNNVVPPAELPDLIAMV
FT                   SRTLGELGKSSAPAAEEIPKLTAAQIRKSITPDHIVSFIDGKPYKSMKRHLTKNGLSPD
FT                   AYRQKYGLPHDYPMVAPNYAAQRSELAKSLGLGQLRRRAMERRAESEAPAAAAGGTKKG
FT                   RGRSKEARSDR"
     atggacgaag aggcaggcac tgtcacccca ggacccgggg cggagaccat cgaactggtc        60
     gccggcattg tttccgcgta cgtgtcgaac aacgtcgtgc ctccagccga attaccggac       120
     ctgatcgcga tggtcagccg gacgcttggc gagcttggca agtcctctgc gcctgccgcc       180
     gaggagattc ccaagctgac ggcggcgcag atccggaaat cgatcactcc ggatcacatc       240
     gtcagtttca tcgacggcaa gccctacaag tcgatgaaga ggcacctgac caagaacggc       300
     ctgagccctg acgcgtaccg tcagaagtat ggcttgccgc acgattatcc gatggtggca       360
     ccgaactatg cggctcagcg atcggaactc gccaagagcc tcggcttggg acagttgcgg       420
     cggcgcgcca tggaaaggcg tgccgagagc gaggccccgg cggccgcggc gggcgggacg       480
     aagaaggggc gcgggcgctc gaaggaggca cggagtgacc gctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page