(data stored in ACNUC7421 zone)

EMBL: CP001349.PE67

CP001349.PE67        Location/Qualifiers
FT   CDS_pept        complement(75893..76396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mpo:Mpop_3481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55119"
FT                   /db_xref="GOA:B8IU74"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU74"
FT                   /inference="protein motif:PFAM:PF03350"
FT                   /protein_id="ACL55119.1"
FT                   /translation="MLERIFERTLFASRWLLAPFYVALMIGLVVLLIKLAQELLHFALH
FT                   AWEAAEAQTILGVLTLVDLSFTASLLIIVMFSGYENFVSKFDHTDHKDWPEWMGTIDFT
FT                   GLKLKLMSSIVAISAIQLLKSFMDVKNNVDRDLMWLVGIHMVFVVSGLLMALTDRVVAG
FT                   HHDK"
     atgttggagc ggatcttcga gcggacgctg tttgcctcac gctggctgct ggcgccgttc        60
     tacgtggcgc tgatgatcgg actggttgtg ttgctgatca agctggcaca ggagttgctg       120
     cacttcgcat tgcacgcctg ggaagccgcc gaggcccaga ccattctcgg cgtgctgacg       180
     ctcgtggatc tgtcgttcac ggcttcactg ctgatcatcg tgatgttctc aggttacgag       240
     aacttcgtct cgaaattcga ccataccgac cacaaggact ggcccgagtg gatgggcacg       300
     atcgacttca cgggactcaa gctcaagctg atgtcgtcca tcgtggccat ctccgccatt       360
     cagctgctca agtcgttcat ggacgtcaag aacaacgtcg accgtgacct gatgtggctg       420
     gtcgggatcc acatggtctt cgtcgtgtcc gggctgctga tggccctcac cgaccgcgtg       480
     gtggctggtc atcatgacaa gtga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page