(data stored in ACNUC7421 zone)

EMBL: CP001349.PE69

CP001349.PE69        Location/Qualifiers
FT   CDS_pept        76846..77127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55121"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55121.1"
FT                   /translation="MPRPYEPHADAIRTAHAIVDDLGHKLAFAARGADPAEIENARHDL
FT                   VVRIAQAITDAEQAAIERAQDCPRPDSGPGSGMGDPYQLFLRLPSGPP"
     atgccgcggc cctatgaacc tcatgcggat gccatccgca ccgcgcacgc catcgtcgac        60
     gacttaggcc ataagctcgc cttcgccgcg cgcggtgccg acccggccga aatcgagaat       120
     gcgcgccatg atctcgtggt caggatcgcg caggcgatca ccgatgccga gcaggcggcc       180
     atcgaacgcg cacaggattg tccgaggccg gactccggtc ctgggagcgg aatgggtgac       240
     ccgtatcagc tgttcctcag gttgccgtcc ggtcctccat ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page